Product: CXCL10 Antibody
Catalog: DF6417
Description: Rabbit polyclonal antibody to CXCL10
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Horse, Rabbit
Mol.Wt.: 10kDa; 11kD(Calculated).
Uniprot: P02778
RRID: AB_2838380

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(91%), Horse(82%), Rabbit(80%)
Clonality:
Polyclonal
Specificity:
CXCL10 Antibody detects endogenous levels of total CXCL10.
RRID:
AB_2838380
Cite Format: Affinity Biosciences Cat# DF6417, RRID:AB_2838380.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

;Interferon gamma induced factor MOB1, mouse, homolog of; Interferon gamma induced protein 10; 10 kDa interferon gamma induced protein; 10 kDa interferon gamma-induced protein; C X C motif chemokine 10; C7; Chemokine (C X C motif) ligand 10; Chemokine CXC motif ligand 10; Crg 2; CRG2; CXCL10; CXCL10(1-73); CXL10_HUMAN; Gamma IP10; Gamma-IP10; gIP 10; GIP10; IFI10; INP 10; INP10; Interferon activated gene 10; Interferon activated gene 10; Interferon gamma induced cell line; Interferon inducible cytokine IP 10; Interferon inducible cytokine IP10; IP 10; IP-10; Mob 1; MOB1; Protein 10 from interferon (gamma) induced cell line; SCYB10; Small inducible cytokine B10; Small inducible cytokine B10 precursor; Small inducible cytokine subfamily B (Cys X Cys) member 10; Small inducible cytokine subfamily B CXC member 10; Small inducible cytokine subfamily B, member 10; Small-inducible cytokine B10;

Immunogens

Immunogen:

A synthesized peptide derived from human CXCL10, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P02778 CXL10_HUMAN:

Mainly secreted by monocytes, endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus (PubMed:11157474). Microglial cells produce CXCL10 in response to viral stimulation (PubMed:12663757).

Description:
This gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Jul 2008]
Sequence:
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
91
Horse
82
Rabbit
80
Bovine
64
Dog
64
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects. Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (By similarity). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation. Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (By similarity).

PTMs:

Several proteases can mediate post-secretion cleavages. DPP4 cleaves CXCL10 on its N-terminal 2 amino acids leading to an antagonist form of CXCL10. This dominant negative form is capable of binding CXCR3 but does not induce signaling. MMP9 cleaves 9 amino acids instead.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Mainly secreted by monocytes, endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus. Microglial cells produce CXCL10 in response to viral stimulation.

Family&Domains:

Belongs to the intercrine alpha (chemokine CxC) family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > RIG-I-like receptor signaling pathway.   (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway.   (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway.   (View pathway)

References

1). Polystyrene microplastics induced male reproductive toxicity in mice. JOURNAL OF HAZARDOUS MATERIALS, 2021 (PubMed: 32659591) [IF=12.2]

2). Neurotoxic A1 astrocytes promote neuronal ferroptosis via CXCL10/CXCR3 axis in epilepsy. Free radical biology & medicine, 2023 (PubMed: 36610561) [IF=7.1]

3). RNF8 enhances the sensitivity of PD-L1 inhibitor against melanoma through ubiquitination of galectin-3 in stroma. Cell death discovery, 2023 (PubMed: 37391451) [IF=7.0]

4). Age-related dysregulation of CXCL9/10 in monocytes is linked to impaired innate immune responses in a mouse model of Staphylococcus aureus osteomyelitis. Cellular and molecular life sciences : CMLS, 2024 (PubMed: 39001897) [IF=6.2]

Application: IHC    Species: Mouse    Sample: bone tissue

Fig. 3 The expression of CXCL9 and CXCL10 are highly activated by S. aureus challenge in bone marrow monocytes of 8-week-old mice. (a) Gene ontology (GO) enrichment analysis of biological processes for upregulated differentially expressed genes (DEGs). The transcriptome data of S. aureus-infected bone and control ones in young mice on day 3 after surgery (GSE166522) were analyzed by bioinformatics. (b) Venn diagram of overlapping DEGs between cytokine-mediated signaling pathway and response to molecule of bacterial origin. (c) Heatmap of 12 overlapping DEGs. (d) mRNA expression of the top 3 highly up-regulated genes (CXCL9, IL-1β, CXCL10) in bone tissue on day 3 after surgery. n = 4/ group. One-way ANOVA with Dunnett’s T3 post hoc test, *p 

5). Identification and Validation of the Prognostic Panel in Clear Cell Renal Cell Carcinoma Based on Resting Mast Cells for Prediction of Distant Metastasis and Immunotherapy Response. Cells, 2023 (PubMed: 36611973) [IF=6.0]

6). Identification and validation of immune and diagnostic biomarkers for interstitial cystitis/painful bladder syndrome by integrating bioinformatics and machine-learning. Frontiers in immunology, 2025 (PubMed: 39917301) [IF=5.7]

7). Human ApoE2 protects mice against Plasmodium berghei ANKA experimental cerebral malaria. mBio, 2023 (PubMed: 37874152) [IF=5.1]

Application: WB    Species: Mouse    Sample:

Fig 5 Splenic and cerebral T cell population changes in hApoE2 and hApoE3 mice after PbA infection. (A) Representative flow cytometric plots showing splenic CD4+ and CD8+ T cells on days 0 and 5 of PbA-infected hApoE2 and hApoE3 mice. (B and C) Percentages (left panel) and absolute numbers (right panel) of splenic CD4+ and CD8+ T cells from PbA-infected mice. n = 4 mice per group. (D) Representative flow cytometric plots showing cerebral CD4+ and CD8+ T cells on days 0 and 5 of PbA-infected hApoE2 and hApoE3 mice. (E and F) Percentages (left panel) and absolute numbers (right panel) of cerebral CD4+ and CD8+ T cells from PbA-infected mice. n = 4 mice per group. (G) Western blots of CXCR3, CXCL9, and CXCL10 in the brain from uninfected and PbA-infected hApoE2 and hApoE3 mice on day 5 pi. (H) Densitometric quantification of CXCR3, CXCL9, and CXCL10 expression in panel G, respectively; band densities were normalized to β-actin. n = 3 experimental repeats. (B, C, E, and F) Mann-Whitney test; (H) Tukey’s multiple comparisons test (CXCR3), and unpaired t-test (CXCL9, CXCL10). *P < 0.05; **P < 0.01; and ***P < 0.001.

8). Pterostilbene, A Bioactive Component of Blueberries, Alleviates Renal Interstitial Fibrosis by Inhibiting Macrophage-Myofibroblast Transition. The American journal of Chinese medicine, 2020 (PubMed: 33148003) [IF=4.8]

Application: WB    Species: Human    Sample: MMT cells

Figure 5. PTB mediated MMT through CXCL10. (A) Gene expression difference of volcano plot between Sham and UUO. (B) Gene expression difference of volcano plot between UUO and PTB treatment. (C) Venn plot suggests that 11 genes may play a role in the inhibition of RIF by PTB. (D) Heatmap analysis. (E) The verification of 11 genes by RT-PCR. (F) The protein level of CXCL10 in vivo. (G) The Luciferase assay showed the regulatory relationship between PTB and CXCL10. *P < 0:05, **P < 0:01, ***P < 0:001, and ****P < 0:0001.

9). DCUN1D1, a new molecule involved in depigmentation via upregulating CXCL10. Experimental dermatology, 2023 (PubMed: 36541112) [IF=3.5]

Application: WB    Species: Mouse    Sample:

FIGURE 2 Immunochemistry for CD8, CXCL10 and CXCR3 in mice skins and Western blotting analysis of JAK/STAT pathway in HaCaT. (A) Detection of CD8, CXCL10 and CXCR3 through immunohistochemistry. Strong staining of CD8 was observed in the AAV-KRT14-Dcun1d1 group, but expression of CD8 was mild in the control and negative control groups. Compared with the other groups, CXCL10 staining was observed in dermal parts of skin biopsy sections from the AAV-KRT14-Dcun1d1 group. CXCR3 staining was close to the portal regions or blood vessels. The expression of CXCR3 was upregulated in the control and negative control groups. Red arrows indicate positive staining. A section of the image (magnification, ×100) in the upper column marked with the brown dotted frame is enlarged and displayed in the lower column. (B), Inhibition of DCUN1D1 by sgRNA was assessed by western blotting. (C), Expression levels of P-JAK1, P-JAK2, P-STAT1 and CXCL10 were assessed by Western blotting. (D–G), Statistical analysis. ns means no significant difference.

Application: IHC    Species: Mouse    Sample:

FIGURE 2 Immunochemistry for CD8, CXCL10 and CXCR3 in mice skins and Western blotting analysis of JAK/STAT pathway in HaCaT. (A) Detection of CD8, CXCL10 and CXCR3 through immunohistochemistry. Strong staining of CD8 was observed in the AAV-KRT14-Dcun1d1 group, but expression of CD8 was mild in the control and negative control groups. Compared with the other groups, CXCL10 staining was observed in dermal parts of skin biopsy sections from the AAV-KRT14-Dcun1d1 group. CXCR3 staining was close to the portal regions or blood vessels. The expression of CXCR3 was upregulated in the control and negative control groups. Red arrows indicate positive staining. A section of the image (magnification, ×100) in the upper column marked with the brown dotted frame is enlarged and displayed in the lower column. (B), Inhibition of DCUN1D1 by sgRNA was assessed by western blotting. (C), Expression levels of P-JAK1, P-JAK2, P-STAT1 and CXCL10 were assessed by Western blotting. (D–G), Statistical analysis. ns means no significant difference.

10). Evidence for the presence of Borrelia burgdorferi in invasive breast cancer tissues. European journal of microbiology & immunology, 2024 (PubMed: 38451280) [IF=3.3]

Application: IF/ICC    Species: Human    Sample: breast cancer tissues

Fig. 3. Representative images of CXCL8 and CXCL10 inflammatory markers on B. burgdorferi-positive and negative breast cancer and normal breast tissues. Panels: B and C show B. burgdorferi-positive breast cancer tissues stained Borrelia monoclonal antibody (green) and CXCL8 monoclonal antibody (red). Panels: F and G show B. burgdorferi-positive breast cancer tissues stained Borrelia monoclonal antibody (green) and CXCL10 monoclonal antibody (red). Panels: D and H show no staining on B. burgdorferi-negative breast cancer tissue samples for both inflammatory markers, CXCL8 and CXCL10 respectively. Panels: A and E show negative control; normal breast tissues are negative for B. burgdorferi and both inflammatory markers. White scale bar: 100 µm

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.