PRDX4 Antibody - #DF6425

Product: | PRDX4 Antibody |
Catalog: | DF6425 |
Description: | Rabbit polyclonal antibody to PRDX4 |
Application: | WB IHC |
Cited expt.: | IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 31kDa; 31kD(Calculated). |
Uniprot: | Q13162 |
RRID: | AB_2838388 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6425, RRID:AB_2838388.
Fold/Unfold
Antioxidant enzyme 372; Antioxidant enzyme AOE372; AOE37 2; AOE37-2; AOE372; EC 1.11.1.15; Peroxiredoxin IV; Peroxiredoxin-4; Peroxiredoxin4; PRDX 4; Prdx4; PRDX4_HUMAN; PRX 4; Prx IV; Prx-IV; PRX4; PrxIV; Thioredoxin dependent peroxide reductase A0372; Thioredoxin Peroxidase (Antioxidant Enzyme); Thioredoxin peroxidase; Thioredoxin peroxidase AO372; Thioredoxin-dependent peroxide reductase A0372; TRANK;
Immunogens
A synthesized peptide derived from human PRDX4, corresponding to a region within C-terminal amino acids.
- Q13162 PRDX4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation.
The enzyme can be inactivated by further oxidation of the cysteine sulfenic acid (C(P)-SOH) to sulphinic acid (C(P)-SO2H) and sulphonic acid (C(P)-SO3H) instead of its condensation to a disulfide bond.
Cytoplasm. Endoplasmic reticulum.
Note: Cotranslationally translocated to and retained within the endoplasmic reticulum. A small fraction of the protein is cytoplasmic.
Belongs to the peroxiredoxin family. AhpC/Prx1 subfamily.
References
Application: IHC Species: Human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.