Product: AIF1/IBA1 Antibody
Catalog: DF6442
Description: Rabbit polyclonal antibody to AIF1/IBA1
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 17kDa(Observed); 17kD(Calculated).
Uniprot: P55008
RRID: AB_2838405

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(91%), Horse(91%), Sheep(91%), Rabbit(91%), Dog(90%)
Clonality:
Polyclonal
Specificity:
AIF1/IBA1 Antibody detects endogenous levels of total AIF1/IBA1.
RRID:
AB_2838405
Cite Format: Affinity Biosciences Cat# DF6442, RRID:AB_2838405.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AIF 1; AIF-1; Aif1; AIF1 protein; AIF1_HUMAN; Allograft inflammatory factor 1; Allograft inflammatory factor 1 splice variant G; allograft inflammatory factor-1 splice variant Hara-1; balloon angioplasty responsive transcription; BART 1; G1; G1 putative splice variant of allograft inflamatory factor 1; IBA 1; IBA1; interferon gamma responsive transcript; Interferon responsive transcript 1; interferon responsive transcript factor 1; Ionized calcium binding adapter molecule 1; Ionized calcium-binding adapter molecule 1; ionized calcium-binding adapter molecule; IRT 1; IRT1; Microglia response factor; MRF1; Protein g1;

Immunogens

Immunogen:

A synthesized peptide derived from human AIF1/IBA1, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P55008 AIF1_HUMAN:

Detected in T-lymphocytes and peripheral blood mononuclear cells.

Description:
This gene is induced by cytokines and interferon. Its protein product is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]
Sequence:
MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
91
Bovine
91
Sheep
91
Rabbit
91
Dog
90
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

PTMs:

Phosphorylated on serine residues.

Subcellular Location:

Cytoplasm>Cytoskeleton. Cell projection>Ruffle membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Phagocytic cup.
Note: Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Detected in T-lymphocytes and peripheral blood mononuclear cells.

References

1). Neuropeptide SP protects against colitis and linked anxiety-like behavior through the putative roles of gut microbiota and metabolite inositol. Nature communications, 2026 (PubMed: 41507168) [IF=16.6]

2). Synergistic Modulation of Microglial Polarization by Acteoside and Ferulic Acid via Dual Targeting of Nrf2 and RORγt to Alleviate Depression-Associated Neuroinflammation. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2025 (PubMed: 40832701) [IF=15.1]

Application: WB    Species: Mouse    Sample:

Figure 2 BDD exerts antidepressant effects by inhibiting the prefrontal Th17 cell-driven RORγt /Act1/TRAF6 pathway mediates microglial activation. A) Sucrose preference (%) in the SPT. B) Immobility time in the FST. C) Retention time in the open field center. D) Percentage of retention time in the open arm. E) Levels of IL-1β, IL-17A, and IL-10 in the mPFC of control or CUMS mice after treatment with saline or BDD. F) Representative flow cytometric analysis and statistical result of CD4+ Th17 cells contents within the mPFC. G) Fluorescence micrographs of DAPI (blue) and RORγt in the mPFC (×40 magnification, scale bar=10 µm). Quantitative analysis of RORγt, Iba1, iNOS, Arg-1, IL-17AR, Act1, and TRAF6 mRNAs H) level and protein expression of RORγt, Iba1, IL-17AR, Act1, and TRAF6 I) in the mPFC of each group of mice. GAPDH was set as the internal control. Data for individual animals are displayed as mean ± SEM (n=6 per/group). J) Immunofluorescence double staining of retinal sections with Iba1 (blue), IL-17AR (red), Act1 (red) or TRAF6 (red) and the ratio of IL-17AR+ Iba1+ / Iba1+ cells, Act1+ Iba1+ / Iba1+ cells and TRAF6+ Iba1+ / Iba1+ cells. Three non-overlapping fields of view were selected randomly in each slice under the fluorescence microscope. Arrows indicate the positive cells. Histogram is the quantification of the percentage of positive cells (n=3 per/group, 2 sections/animal). ** p

3). NAD+-Boosters Improve Mitochondria Quality Control In Parkinson's Disease Models Via Mitochondrial UPR. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2025 (PubMed: 40685704) [IF=15.1]

4). Nonenzymatic function of DPP4 promotes diabetes-associated cognitive dysfunction through IGF-2R/PKA/SP1/ERp29/IP3R2 pathway-mediated impairment of Treg function and M1 microglia polarization. METABOLISM-CLINICAL AND EXPERIMENTAL, 2023 (PubMed: 36302455) [IF=10.8]

5). Intestinal homeostasis disrupted by Periodontitis exacerbates Alzheimer's Disease in APP/PS1 mice. Journal of neuroinflammation, 2024 (PubMed: 39425119) [IF=9.3]

6). Exosomes derived from bone-marrow mesenchymal stem cells alleviate cognitive decline in AD-like mice by improving BDNF-related neuropathology. Journal of neuroinflammation, 2022 (PubMed: 35130907) [IF=9.3]

Application: IF/ICC    Species: Mouse    Sample:

Fig. 5 Lateral ventricle administration of BMSC-exos inhibited the proliferation and activation of microglia in the hippocampus of mice injected with STZ. A Fluorescence detection of microglia marker IBA1 in hippocampus B Quantification of the number of IBA1 positive cells. C Microglia in different states (left: resting state; right: activated state); D The ratio of activated microglia to the total number of microglia. Data are presented as means ± SEM, with n = 3 in each group

7). The impact of repetitive neonatal procedural pain on cognitive behavioral development in male Mice: A microglial Perspective. Brain, behavior, and immunity, 2026 (PubMed: 41241084) [IF=8.8]

8). Red ginseng polysaccharide targets the PI3K/AKT/mTOR pathway to induce mitochondrial apoptosis in bladder cancer. International journal of biological macromolecules, 2026 (PubMed: 41864385) [IF=7.7]

9). 17β-trenbolone increases circulating myeloid-derived MMP8 in CSDS-induced mice and drives depressive tendencies to social threat. Environmental research, 2025 (PubMed: 40897223) [IF=7.7]

10). Efficacy and safety of intrathecal human umbilical cord-derived mesenchymal stromal cell therapy for bone cancer pain: a preclinical study. Stem cell research & therapy, 2025 (PubMed: 41276847) [IF=7.5]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.