UCP3 Antibody - #DF6443
| Product: | UCP3 Antibody |
| Catalog: | DF6443 |
| Description: | Rabbit polyclonal antibody to UCP3 |
| Application: | WB IHC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Dog |
| Mol.Wt.: | 34kDa; 34kD(Calculated). |
| Uniprot: | P55916 |
| RRID: | AB_2838406 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6443, RRID:AB_2838406.
Fold/Unfold
Mitochondrial uncoupling protein 3; SLC25A9; Solute carrier family 25 member 9; UCP 3; UCP3; UCP3_HUMAN; Uncoupling protein 3; Uncoupling protein 3 mitochondrial proton carrier;
Immunogens
A synthesized peptide derived from human UCP3, corresponding to a region within C-terminal amino acids.
Only in skeletal muscle and heart. Is more expressed in glycolytic than in oxidative skeletal muscles.
- P55916 UCP3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRGVLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRILAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDVVKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRALMKVQMLRESPF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance.
Mitochondrion inner membrane>Multi-pass membrane protein.
Only in skeletal muscle and heart. Is more expressed in glycolytic than in oxidative skeletal muscles.
Belongs to the mitochondrial carrier (TC 2.A.29) family.
References
Application: WB Species: mouse Sample: skeletal muscle
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.