Product: Angiogenin Antibody
Catalog: DF6449
Description: Rabbit polyclonal antibody to Angiogenin
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Mol.Wt.: 17kDa; 17kD(Calculated).
Uniprot: P03950
RRID: AB_2838412

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Angiogenin Antibody detects endogenous levels of total Angiogenin.
RRID:
AB_2838412
Cite Format: Affinity Biosciences Cat# DF6449, RRID:AB_2838412.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

ALS9; AMYOTROPHIC LATERAL SCLEROSIS; ANG 1; ANG; ANG I; ANG1; ANGI; ANGI_HUMAN; Angiogenin; Angiogenin ribonuclease RNase A family, 5; Epididymis luminal protein 168; HEL168; MGC22466; MGC71966; Ribonuclease 5; Ribonuclease RNase A Family 5; RNase 5; RNASE4; RNASE5;

Immunogens

Immunogen:

A synthesized peptide derived from human Angiogenin, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P03950 ANGI_HUMAN:

Expressed predominantly in the liver. Also detected in endothelial cells and spinal cord neurons.

Description:
Angiopoietins are a family of Tie receptor ligands. There are four angiopoietins discovered so far: angiopoietins 1, 2, 3 and 4 (Ang1, 2, 3, and 4) (1-3). Ang1 binds to the Tie-2 receptor and leads to its autophosphorylation and subsequent activation of downstream signaling pathways. It plays an important role in blood vessel formation, maturation and subsequent stabilization (1,4,5). Ang2 is an endothelium-specific growth factor that functions as an antagonist to Ang1, promotes vascular associated proinflammatory function, destabilizes quiescent endothelium, leads to vascular leakage and vascular destablization and remodeling (2,6,7). Ang2 is selectively expressed in many tumor tissues where, combined with other growth factors such as VEGF, it can promote vascular remodeling, angiogenesis and inflammation (7-9).
Sequence:
MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP

Research Backgrounds

Function:

Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo.

Subcellular Location:

Cytoplasmic vesicle>Secretory vesicle lumen. Secreted. Nucleus. Nucleus>Nucleolus.
Note: Rapidly endocytosed by target cells and translocated to the nucleus where it accumulates in the nucleolus and binds to DNA (PubMed:12051708).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed predominantly in the liver. Also detected in endothelial cells and spinal cord neurons.

Family&Domains:

Belongs to the pancreatic ribonuclease family.

References

1). Polyphenol-driven facile assembly of a nanosized acid fibroblast growth factor-containing coacervate accelerates the healing of diabetic wounds. Acta Biomaterialia, 2023 (PubMed: 36460288) [IF=9.4]

2). Inhibitory effect of miR‑182‑5p on retinal neovascularization by targeting angiogenin and BDNF. Molecular Medicine Reports, 2022 (PubMed: 34935052) [IF=3.4]

Application: WB    Species: Human    Sample: HRECs

Figure 1. OIR-induced suppression of miR-182-5p and increased expression of ANG and BDNF. (A) The potential binding sites of miR-182-5p on 3′-UTR of ANG and BDNF predicted by TargetScan. (B) The reverse transcription-quantitative PCR analysis showed miR-182-5p was inhibited in retinas of OIR mouse compared with normal mouse. (C) The mRNA levels of ANG and BDNF were increased in OIR mouse retina, compared with normal mouse. (D) The representative grey bands of ANG and BDNF by western blotting. (E) The quantitation demonstrated the enhanced protein levels of ANG and BDNF in OIR mouse retinas. Means ± SDs. **P<0.01 vs. the NC group (n=6). OIR, oxygen-induced retinopathy; ANG, angiogenin; BDNF, brain-derived neurotrophic factor; miR, microRNA; NC, negative control.

3). Menstrual Blood-Derived Endometrial Stem Cell Transplantation Improves Male Reproductive Dysfunction in T1D Mice by Enhancing Antioxidative Capacity. Reproductive sciences (Thousand Oaks, Calif.), 2024 (PubMed: 38396297) [IF=2.6]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.