Angiogenin Antibody - #DF6449
| Product: | Angiogenin Antibody |
| Catalog: | DF6449 |
| Description: | Rabbit polyclonal antibody to Angiogenin |
| Application: | WB IHC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 17kDa; 17kD(Calculated). |
| Uniprot: | P03950 |
| RRID: | AB_2838412 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6449, RRID:AB_2838412.
Fold/Unfold
ALS9; AMYOTROPHIC LATERAL SCLEROSIS; ANG 1; ANG; ANG I; ANG1; ANGI; ANGI_HUMAN; Angiogenin; Angiogenin ribonuclease RNase A family, 5; Epididymis luminal protein 168; HEL168; MGC22466; MGC71966; Ribonuclease 5; Ribonuclease RNase A Family 5; RNase 5; RNASE4; RNASE5;
Immunogens
A synthesized peptide derived from human Angiogenin, corresponding to a region within the internal amino acids.
Expressed predominantly in the liver. Also detected in endothelial cells and spinal cord neurons.
- P03950 ANGI_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP
Research Backgrounds
Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo.
Cytoplasmic vesicle>Secretory vesicle lumen. Secreted. Nucleus. Nucleus>Nucleolus.
Note: Rapidly endocytosed by target cells and translocated to the nucleus where it accumulates in the nucleolus and binds to DNA (PubMed:12051708).
Expressed predominantly in the liver. Also detected in endothelial cells and spinal cord neurons.
Belongs to the pancreatic ribonuclease family.
References
Application: WB Species: Human Sample: HRECs
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.