Product: Cystatin C Antibody
Catalog: DF6457
Description: Rabbit polyclonal antibody to Cystatin C
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat, Monkey
Mol.Wt.: 16kDa; 16kD(Calculated).
Uniprot: P01034
RRID: AB_2838419

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Monkey
Clonality:
Polyclonal
Specificity:
Cystatin C Antibody detects endogenous levels of total Cystatin C.
RRID:
AB_2838419
Cite Format: Affinity Biosciences Cat# DF6457, RRID:AB_2838419.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AD 8; AD8; Amyloid angiopathy and cerebral hemorrhage; ARMD11; bA218C14.4 (cystatin C); bA218C14.4; Cst 3; Cst3; CST3 protein; Cystatin 3; Cystatin-3; Cystatin-C; Cystatin3; CystatinC; CYTC_HUMAN; Epididymis secretory protein Li 2; Gamma trace; Gamma-trace; HCCAA; HEL S 2; MGC117328; Neuroendocrine basic polypeptide; Post gamma globulin; Post-gamma-globulin;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P01034 CYTC_HUMAN:

Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ovary and the lowest in the submandibular gland.

Description:
Cystatin C is a 14 kDa member of the Cystatin superfamily of cysteine protease inhibitors (1). Most cell types secrete Cystatin C (1). Cystatin C inhibits cathepsins, and thereby may function as a tumor suppressor by inhibiting cathepsin mediated tumor cell invasion (2). In addition, this tumor suppressor function can also be attributed to Cystatin C's ability to antagonize TGF-β1 signaling (2,3). Cystatin C may also modulate antigen presentation through its ability to inhibit cathepsins (4). Cystatin C is also a biomarker for kidney dysfunction (5).
Sequence:
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

PTMs - P01034 As Substrate

Site PTM Type Enzyme
S43 Phosphorylation

Research Backgrounds

Function:

As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.

PTMs:

The Thr-25 variant is O-glycosylated with a core 1 or possibly core 8 glycan. The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ovary and the lowest in the submandibular gland.

Subunit Structure:

Homodimer.

Family&Domains:

Belongs to the cystatin family.

Research Fields

· Organismal Systems > Digestive system > Salivary secretion.

References

1). Melatonin protects against sarcopenia in middle-aged mice. Histology and histopathology, 2024 (PubMed: 39385610) [IF=2.5]

Application: WB    Species: Mouse    Sample: GA tissues

Figure 4. The effects of MEL on the PGC-1α/TFAM pathway in GA tissues of middle-aged mice a-c. Western blot and qRT-PCR were applied to detect the effects of MEL on PGC-1α/TFAM pathwayrelated protein and mRNA levels, including cytochrome c oxidase subunit 4 (COX4), cystatin C (CYTC), nuclear respiratory factor 1 (NRF-1), mitochondrial transcription factor A (TFAM), p-P38, P38, and peroxisome proliferator-activated receptor γ coactivator-1α (PGC-1α), n=3. Data are manifested as mean ± SD * P

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.