Product: SULT1A1 Antibody
Catalog: DF6490
Description: Rabbit polyclonal antibody to SULT1A1
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 34kDa; 34kD(Calculated).
Uniprot: P50225
RRID: AB_2838452

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
SULT1A1 Antibody detects endogenous levels of total SULT1A1.
RRID:
AB_2838452
Cite Format: Affinity Biosciences Cat# DF6490, RRID:AB_2838452.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Aryl sulfotransferase 1; HAST1/HAST2; Human aryl sulfotransferase mRNA complete cds; MGC131921; MGC5163; OTTHUMP00000162568; OTTHUMP00000162569; P PST 1; P PST; P-PST 1; Phenol sulfating phenol sulfotransferase 1; Phenol sulfotransferase 1; Phenol-sulfating phenol sulfotransferase 1; PST; ST1A1; ST1A1_HUMAN; ST1A3; STP; STP1; Sulfotransferase 1A1; Sulfotransferase family 1A phenol preferring member 1; Sulfotransferase family cytosolic 1A phenol preferring member 1; Sulfotransferase phenol preferring 1; SULT1A1; Thermostable phenol sulfotransferase; Thermostable phenol sulfotransferase1; Ts-PST; TSPST1;

Immunogens

Immunogen:

A synthesized peptide derived from human SULT1A1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P50225 ST1A1_HUMAN:

Liver, lung, adrenal, brain, platelets and skin.

Description:
SULT1A1, also named as ST1A1, P-PST 1, ST1A3, Ts-PST, P-PST 1, STP and STP1, belongs to the sulfotransferase 1 family. It catalyzes the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. SULT1A1 is also responsible for the sulfation and activation of minoxidil. It mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity.
Sequence:
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Research Backgrounds

Function:

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Liver, lung, adrenal, brain, platelets and skin.

Family&Domains:

Belongs to the sulfotransferase 1 family.

Research Fields

· Human Diseases > Cancers: Overview > Chemical carcinogenesis.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.