RBP4 Antibody - #DF6491
| Product: | RBP4 Antibody |
| Catalog: | DF6491 |
| Description: | Rabbit polyclonal antibody to RBP4 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 23kDa; 23kD(Calculated). |
| Uniprot: | P02753 |
| RRID: | AB_2838453 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6491, RRID:AB_2838453.
Fold/Unfold
OTTHUMP00000020114; OTTHUMP00000020115; OTTHUMP00000020116; Plasma retinol binding protein 4; Plasma retinol-binding protein; Plasma retinol-binding protein(1-176); PRBP; PRO2222; RBP; RBP4; RDCCAS; RET4_HUMAN; Retinol binding protein 4; Retinol binding protein 4 interstitial; Retinol binding protein 4 plasma;
Immunogens
A synthesized peptide derived from human RBP4, corresponding to a region within the internal amino acids.
- P02753 RET4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Retinol-binding protein that mediates retinol transport in blood plasma. Delivers retinol from the liver stores to the peripheral tissues (Probable). Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane.
Secreted.
Detected in blood plasma and in urine (at protein level).
Belongs to the calycin superfamily. Lipocalin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.