SPARC Antibody - #DF6503
| Product: | SPARC Antibody |
| Catalog: | DF6503 |
| Description: | Rabbit polyclonal antibody to SPARC |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 35kDa; 35kD(Calculated). |
| Uniprot: | P09486 |
| RRID: | AB_2838465 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6503, RRID:AB_2838465.
Fold/Unfold
AA517111; Basement membrane protein 40; Basement-membrane protein 40; BM 40; BM-40; BM40; Cysteine rich protein; hm:zeh0062; MGC128090; OI17; ON; Osteonectin; Secreted acidic cystein rich glycoprotein; Secreted protein acidic and rich in cysteine; Secreted protein acidic cysteine rich (osteonectin); Secreted protein acidic cysteine rich; SPARC; SPRC; SPRC_HUMAN;
Immunogens
A synthesized peptide derived from human SPARC, corresponding to a region within the internal amino acids.
- P09486 SPRC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca(2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.
Secreted>Extracellular space>Extracellular matrix>Basement membrane.
Note: In or around the basement membrane.
Belongs to the SPARC family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.