KIR3DL1 Antibody - #DF6505
Product: | KIR3DL1 Antibody |
Catalog: | DF6505 |
Description: | Rabbit polyclonal antibody to KIR3DL1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 49kDa; 49kD(Calculated). |
Uniprot: | P43629 |
RRID: | AB_2838467 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6505, RRID:AB_2838467.
Fold/Unfold
AMB11; CD158 antigen-like family member E; CD158e; CD158e antigen; CD158E1; CD158E1/2; CD158E2; CL11; CL2; HLA-BW4-specific inhibitory NK cell receptor; KI3L1_HUMAN; killer cell immunoglobulin like receptor; Killer cell immunoglobulin like receptor three domains , short cytoplasmic tail, 1; Killer cell immunoglobulin like receptor three domains long cytoplasmic tail 1; Killer cell immunoglobulin-like receptor 3DL1; KIR; KIR antigen 3DL1; KIR G1; Kir3dl1; KIR3DS1; Kirl1; Kirl2; Krl1; MGC119726; MGC119728; MGC126589; MGC126591; MHC class I NK cell receptor; Natural killer associated transcript 3; Natural killer cell inhibitory receptor; Natural killer-associated transcript 3; NK receptor; NK-associated transcript 10; NK-associated transcript 3; NK-associated transcript 3delIg1; NKAT-3; NKAT10; NKAT3; NKB1; NKB1B; p70 killer cell inhibitory receptor; p70 natural killer cell receptor clones CL 2/CL 11; p70 natural killer cell receptor clones CL-2/CL-11; p70 NK receptor CL-2/CL-11;
Immunogens
A synthesized peptide derived from human KIR3DL1, corresponding to a region within the internal amino acids.
- P43629 KI3L1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP
Research Backgrounds
Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.
Cell membrane>Single-pass type I membrane protein.
Ig-like C2-type domain 2 mediates specificity through recognition of the Bw4 epitope.
Belongs to the immunoglobulin superfamily.
Research Fields
· Human Diseases > Immune diseases > Graft-versus-host disease.
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.