XPA Antibody - #DF6513
Product: | XPA Antibody |
Catalog: | DF6513 |
Description: | Rabbit polyclonal antibody to XPA |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Xenopus |
Mol.Wt.: | 31kDa; 31kD(Calculated). |
Uniprot: | P23025 |
RRID: | AB_2838475 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6513, RRID:AB_2838475.
Fold/Unfold
DNA repair protein complementing XP A cells; DNA repair protein complementing XP-A cells; DNA repair protein complementing XPA cells; Excision repair controlling; Xeroderma pigmentosum 1; Xeroderma pigmentosum complementation group A; Xeroderma pigmentosum group A complementing protein; Xeroderma pigmentosum group A-complementing protein; XP 1; XP1; xpa; XPA_HUMAN; Xpac;
Immunogens
A synthesized peptide derived from human XPA, corresponding to a region within the internal amino acids.
- P23025 XPA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation.
ATR-dependent phosphorylation of XPA at Ser-196 is important for cell survival in response to UV damage.
Ubiquitinated by HERC2 leading to degradation by the proteasome.
Nucleus.
Expressed in various cell lines and in skin fibroblasts.
Belongs to the XPA family.
Research Fields
· Genetic Information Processing > Replication and repair > Nucleotide excision repair.
· Human Diseases > Drug resistance: Antineoplastic > Platinum drug resistance.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.