S100A4 Antibody - #DF6516

(5)   (10)  
Product: S100A4 Antibody
Catalog: DF6516
Description: Rabbit polyclonal antibody to S100A4
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Rabbit, Dog
Mol.Wt.: 12kDa; 12kD(Calculated).
Uniprot: P26447
RRID: AB_2838478

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Horse(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
S100A4 Antibody detects endogenous levels of total S100A4.
RRID:
AB_2838478
Cite Format: Affinity Biosciences Cat# DF6516, RRID:AB_2838478.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

18A2; 42A; calcium Placental protein; Calvasculin; CAPL; Fibroblast specific protein 1 (FSP1); Fibroblast specific protein 1; Fibroblast specific protein; FSP1; Leukemia multidrug resistance associated protein; Malignant transformation suppression 1 (MTS1); Malignant transformation suppression 1; Metastasin; MTS1; OTTHUMP00000015467; OTTHUMP00000015468; P9KA; PEL98; Placental calcium-binding protein; Protein Mts1; Protein S100 A4; Protein S100-A4; S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); S100 calcium binding protein A4; S100 calcium-binding protein A4; S100a4; S10A4_HUMAN;

Immunogens

Immunogen:
Uniprot:

P26447(S10A4_HUMAN) >>Visit HPA database.

Gene(ID):
S100A4(6275)
Expression:
P26447 S10A4_HUMAN:

Ubiquitously expressed.

Description:
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Sequence:
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Dog
100
Rabbit
100
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P26447 As Substrate

Site PTM Type Enzyme
M1 Acetylation
K7 Acetylation
K18 Acetylation
K18 Ubiquitination
K22 Sumoylation
K22 Ubiquitination
K28 Sumoylation
K31 Acetylation
K31 Sumoylation
K31 Ubiquitination
S32 Phosphorylation
K35 Acetylation
K35 Ubiquitination
S44 Phosphorylation
K48 Acetylation
K48 Ubiquitination
K57 Acetylation
K57 Ubiquitination
S64 Phosphorylation
K96 Sumoylation
K96 Ubiquitination

Research Backgrounds

Tissue Specificity:

Ubiquitously expressed.

Subunit Structure:

Homodimer. Interacts with PPFIBP1 in a calcium-dependent mode.

Family&Domains:

Belongs to the S-100 family.

References

1). Exosomal miR-500a-5p derived from cancer-associated fibroblasts promotes breast cancer cell proliferation and metastasis through targeting USP28. Theranostics, 2023 (PubMed: 33664871) [IF=12.4]
2). Long-Term Administration of Triterpenoids From Ganoderma lucidum Mitigates Age-Associated Brain Physiological Decline via Regulating Sphingolipid Metabolism and Enhancing Autophagy in Mice. Frontiers in Aging Neuroscience, 2021 (PubMed: 34025387) [IF=4.1]

Application: WB    Species: Mice    Sample: liver and spleen tissue

FIGURE 6 Improvement of multiple organ aging after long-term administration of TGL. TGL shows an improvement in the liver and spleen. (A) TGL shows inhibition of the expressions in mTOR and p-mTOR of the liver. (B) The expression of GPX4 and S100A4. (C) TGL shows inhibition of telomere shortening in the liver. Data are presented as the means ± SD of more than six independent experiments and more than three independent experiments in Western blot. *p < 0.05, **p < 0.01, ***p < 0.001, and ns, not statistically significant.

Application: WB    Species: mouse    Sample: liver

FIGURE 6 | Improvement of multiple organ aging after long-term administration of TGL. TGL shows an improvement in the liver and spleen.(C) TGL shows inhibition of telomere shortening in the liver. Data are presented as the means ± SD of more than six independent experiments and more than three independent experiments in Western blot.
3). Regulation of cardiac fibroblasts reprogramming into cardiomyocyte-like cells with a cocktail of small molecule compounds. FEBS open bio, 2024 (PubMed: 38693086) [IF=2.8]

Application: IF/ICC    Species: Rat    Sample: cardiac fibroblasts

Fig. 1 Morphology and identification of cardiac fibroblasts (CFs) with Vimentin, discoidin domain receptor 2 (DDR2), and fibroblasts specific protein1 (FSP1). (A) Morphology of CFs by phase‐contrast imaging. (B) Colocalization of Vimentin and DDR2 on passage 3 of CF detected by immunofluorescence assays. (C) Colocalization of FSP1 and DDR2 on passage 3 of CF detected by immunofluorescence assays. Scale bars: 100 μm. (D) Statistics of positive expression rates of Vimentin, FSP1, and DDR2. The difference was assayed using one‐way ANOVA with the Tukey–Kramer posttest. Data are presented as the mean ± SEM; n = 3.
4). Suppression of ADAM8 attenuates angiotensin II-induced cardiac fibrosis and endothelial-mesenchymal transition via inhibiting TGF-β1/Smad2/Smad3 pathways. EXPERIMENTAL ANIMALS, 2022 (PubMed: 34615811) [IF=2.2]

Application: WB    Species: Mouse    Sample: heart endothelial cells

Fig. 4. ADAM8 silencing suppresses Ang II-induced EndMT in vivo. (A) Representative western blot bands of α-SMA, FSP1 and VE-cadherin were displayed. (B-D) The quantitative analysis of α-SMA, FSP1 and VE-cadherin was showed. *P<0.05, ***P<0.001 and ****P<0.0001. Multiple comparisons were performed using one-way ANOVA followed by Bonferroni’s post hoc test.

Application: IF/ICC    Species: Mouse    Sample: heart endothelial cells

Fig. 6. ADAM8 inhibition ameliorated Ang II-induced EndMT in vitro. (A) Primary mouse heart endothelial cells. (B) The purity of endothelial cells was measured via flow cytometry. (C, D) The endothelial cells were infected with lentivirus-shRNA targeting ADAM8. Lentivirus infection efficiency was detected via real-time PCR and western blot. (E-G) The EndMT-related makers, α-SMA, FSP1 and VE-cadherin, were determined by real-time PCR. (H) Endothelial cells were co-immunostained to detect CD31 (green) and FSP-1 (red). **P<0.01, ***P<0.001 and ****P<0.0001. Multiple comparisons were performed using one-way ANOVA followed by Bonferroni’s post hoc test.
5). Downregulation of acylglycerol kinase suppresses high glucose-induced endothelial-mesenchymal transition in HRECs through regulating the LPAR1/TGF-β/Notch signaling pathway. CANADIAN JOURNAL OF PHYSIOLOGY AND PHARMACOLOGY, 2021 (PubMed: 34559978) [IF=1.7]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.