AHSG Antibody - #DF6528
Product: | AHSG Antibody |
Catalog: | DF6528 |
Description: | Rabbit polyclonal antibody to AHSG |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 39kDa; 39kD(Calculated). |
Uniprot: | P02765 |
RRID: | AB_2838490 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6528, RRID:AB_2838490.
Fold/Unfold
59 kDa bone sialic acid-containing protein; A2HS; Aa2-066; AHS; Ahsg alpha-2-HS-glycoprotein; Ahsg; Alpha 2 HS Glycoprotein; Alpha 2 Z globulin; Alpha-2-HS-glycoprotein; Alpha-2-HS-glycoprotein chain B; Alpha-2-Z-globulin; Asialofetuin; Ba alpha 2 glycoprotein; Ba-alpha-2-glycoprotein; BSP; Countertrypin; Fetua; FETUA_HUMAN; Fetuin , mouse, homolog of; Fetuin A; Fetuin-A; Glycoprotein PP63; HSGA; pp63;
Immunogens
A synthesized peptide derived from human AHSG, corresponding to a region within C-terminal amino acids.
Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.
- P02765 FETUA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
Research Backgrounds
Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions.
Phosphorylated by FAM20C in the extracellular medium.
O- and N-glycosylated. O-glycosylated with core 1 or possibly core 8 glycans. N-glycan at Asn-156: Hex5HexNAc4; N-glycan heterogeneity at Asn-176: Hex5HexNAc4 (major) and Hex6HexNAc5 (minor).
Secreted.
Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.
Belongs to the fetuin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.