SAA1/2 Antibody - #DF6533
| Product: | SAA1/2 Antibody |
| Catalog: | DF6533 |
| Description: | Rabbit polyclonal antibody to SAA1/2 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 14kDa; 14kD(Calculated). |
| Uniprot: | P0DJI8 | P0DJI9 |
| RRID: | AB_2838495 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6533, RRID:AB_2838495.
Fold/Unfold
PIG4; SAA; SAA1; SAA2; Serum amyloid A 2 protein; Serum amyloid A protein; Serum amyloid A1; Serum amyloid A2; TP53I4; Tumor protein p53 inducible protein 4;
Immunogens
A synthesized peptide derived from human SAA1/2, corresponding to a region within the internal amino acids.
Expressed by the liver; secreted in plasma (at protein level).
P0DJI9 SAA2_HUMAN:Expressed by the liver; secreted in plasma.
- P0DJI8 SAA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
- P0DJI9 SAA2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Major acute phase protein.
This protein is the precursor of amyloid protein A, which is formed by the removal of approximately 24 residues from the C-terminal end.
Secreted.
Expressed by the liver; secreted in plasma (at protein level).
Belongs to the SAA family.
Major acute phase reactant. Apolipoprotein of the HDL complex.
This protein is the precursor of amyloid protein A, which is formed by the removal of approximately 24 residues from the C-terminal end.
Secreted.
Expressed by the liver; secreted in plasma.
Belongs to the SAA family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.