Product: CD3E Antibody
Catalog: DF6594
Description: Rabbit polyclonal antibody to CD3E
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 23kDa; 23kD(Calculated).
Uniprot: P07766
RRID: AB_2838556

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(91%), Horse(91%), Sheep(100%), Rabbit(100%), Dog(91%), Chicken(80%)
Clonality:
Polyclonal
Specificity:
CD3 epsilon Antibody detects endogenous levels of total CD3.
RRID:
AB_2838556
Cite Format: Affinity Biosciences Cat# DF6594, RRID:AB_2838556.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

4930549J05Rik; A430104F18Rik; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; CD247 molecule; CD3; CD3 antigen, delta subunit; CD3 delta; CD3 epsilon; CD3 eta; CD3 gamma; CD3 molecule delta polypeptide; CD3 molecule, epsilon polypeptide; CD3 molecule, gamma polypeptide; CD3 zeta; CD3-DELTA; CD3d; CD3D antigen delta polypeptide; CD3d antigen, delta polypeptide (TiT3 complex); CD3d molecule delta; CD3d molecule delta CD3 TCR complex; CD3d molecule, delta (CD3-TCR complex); CD3D_HUMAN; CD3E; CD3e antigen; CD3E antigen epsilon polypeptide; CD3e antigen, epsilon polypeptide (TiT3 complex); CD3e molecule epsilon; CD3e molecule epsilon CD3 TCR complex; CD3e molecule, epsilon (CD3-TCR complex); CD3epsilon; CD3G; CD3g antigen; CD3G antigen gamma polypeptide; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule gamma; CD3g molecule gamma CD3 TCR complex; CD3g molecule, gamma (CD3-TCR complex); CD3H; CD3Q; CD3Z; CD3zeta; Ctg3; FLJ17620; FLJ17664; FLJ18683; FLJ79544; FLJ94613; IMD19; Leu-4; MGC138597; OKT3, delta chain; OTTHUMP00000032544; T cell receptor; T cell receptor T3 delta chain; T cell receptor T3 gamma chain; T cell receptor T3 zeta chain; T cell receptor zeta chain; T cell surface antigen T3/Leu 4 epsilon chain; T cell surface glycoprotein CD3; T cell surface glycoprotein CD3 delta chain; T cell surface glycoprotein CD3 epsilon chain; T cell surface glycoprotein CD3 gamma chain; T cell surface glycoprotein CD3 zeta chain; T-cell antigen receptor complex, delta subunit of T3; T-cell antigen receptor complex, epsilon subunit of T3; T-cell antigen receptor complex, gamma subunit of T3; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor T3 delta chain; T-cell receptor T3 gamma chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 delta chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 gamma chain; T3; T3d; T3e; T3g; T3z; TCRE; TCRk; Tcrz; TCRzeta antibody

Immunogens

Immunogen:
Uniprot:
Description:
When T cells encounter antigens via the T cell receptor (TCR), information about the quantity and quality of antigens is relayed to the intracellular signal transduction machinery (1). This activation process depends mainly on CD3 (Cluster of Differentiation 3), a multiunit protein complex that directly associates with the TCR. CD3 is composed of four polypeptides: ζ, γ, ε and δ. Each of these polypeptides contains at least one immunoreceptor tyrosine-based activation motif (ITAM) (2). Engagement of TCR complex with foreign antigens induces tyrosine phosphorylation in the ITAM motifs and phosphorylated ITAMs function as docking sites for signaling molecules such as ZAP-70 and p85 subunit of PI-3 kinase (3,4). TCR ligation also induces a conformational change in CD3ε, such that a proline-region is exposed and then associates with the adapter protein Nck (5).
Sequence:
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Sheep
100
Rabbit
100
Horse
91
Bovine
91
Dog
91
Chicken
80
Xenopus
70
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P07766 As Substrate

Site PTM Type Enzyme
K64 Ubiquitination
K73 Ubiquitination
S77 Phosphorylation
S83 Phosphorylation
K85 Ubiquitination
K104 Ubiquitination
K177 Ubiquitination
Y188 Phosphorylation P06239 (LCK) , P06241 (FYN)
Y199 Phosphorylation P06241 (FYN) , P06239 (LCK)
S200 Phosphorylation

Research Backgrounds

Function:

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Initiates the TCR-CD3 complex assembly by forming the two heterodimers CD3D/CD3E and CD3G/CD3E. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.

PTMs:

Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

The TCR-CD3 complex is composed of a CD3D/CD3E and a CD3G/CD3E heterodimers that preferentially associate with TCRalpha and TCRbeta, respectively, to form TCRalpha/CD3E/CD3G and TCRbeta/CD3G/CD3E trimers. In turn, the hexamer interacts with CD3Z homodimer to form the TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta. Interacts with CD6. Interacts with NCK1. Interacts with NUMB; this interaction is important for TCR-CD3 internalization and subsequent degradation.

References

1). Single-Cell Atlas of Human Ovaries Reveals The Role Of The Pyroptotic Macrophage in Ovarian Aging. Advanced science (Weinheim, Baden-Wurttemberg, Germany), 2024 (PubMed: 38036420) [IF=15.1]

2). Harnessing the power of traceable system C‑GAP: homologous‑targeting to fire up T‑cell immune responses with low‑dose irradiation. JOURNAL OF NANOBIOTECHNOLOGY, 2025 [IF=10.6]

3). VEGFC ameliorates salt-sensitive hypertension and hypertensive nephropathy by inhibiting NLRP3 inflammasome via activating VEGFR3-AMPK dependent autophagy pathway. Cellular and molecular life sciences : CMLS, 2023 (PubMed: 37837447) [IF=6.2]

4). Dupilumab improve acquired reactive perforating collagenosis characterized by type 2 inflammation. Frontiers in Immunology, 2023 (PubMed: 37638036) [IF=5.7]

Application: IHC    Species: Human    Sample:

Figure 3 Representative images and data reporting hematoxylin and eosin staining, CD3, CD20, GATA3 and T-bet staining of APRC, AD and HC samples. Magnification: ×40, ×200, AD, atopic dermatitis, ARPC, acquired reactive perforating collagenosis, HC, healthy control, HE, hematoxylin and eosin.

5). Protective effects of triptolide on TLR4 mediated autoimmune and inflammatory response induced myocardial fibrosis in diabetic cardiomyopathy. JOURNAL OF ETHNOPHARMACOLOGY, 2016 (PubMed: 27558948) [IF=4.8]

Application: IHC    Species: mouse    Sample:

Representative Immunohistochemistry staining of TLR4 (A), CD68(C) as well as CD3 (D).

6). Protective effect and mechanism of nicotinamide adenine dinucleotide against optic neuritis in mice with experimental autoimmune encephalomyelitis. International Immunopharmacology, 2021 (PubMed: 34174704) [IF=4.8]

Application: IF/ICC    Species: Mice    Sample: EAE mice

Fig. 2. Effect of NAD+ intervention on the optic nerve inflammation in EAE mice. The optic nerve was collected 25 days after immunization. The optic nerve sections were stained by H&E, and the extent of inflammatory cell infiltration was analyzed by scoring (A). (n = 12) The infiltration of T cells and T helper cells in the optic nerves were determined by CD3 staining (B) and CD4 staining (C). (n = 6) *p < 0.05. Error bars, SD.

7). Combinational Deletions of MGF360-9L and MGF505-7R Attenuated Highly Virulent African Swine Fever Virus and Conferred Protection against Homologous Challenge. Journal of Virology, 2022 (PubMed: 35867564) [IF=4.0]

8). Иммуногистохимическая характеристика биопсийных образцов десны в области беззубого альвеолярного края челюсти. Пародонтология, 2024

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.