FKBP1A Antibody - #DF6599
| Product: | FKBP1A Antibody |
| Catalog: | DF6599 |
| Description: | Rabbit polyclonal antibody to FKBP1A |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Rabbit, Xenopus |
| Mol.Wt.: | 12kDa; 12kD(Calculated). |
| Uniprot: | P62942 |
| RRID: | AB_2838561 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6599, RRID:AB_2838561.
Fold/Unfold
12 kDa FK506-binding protein; 12 kDa FKBP; Calstabin 1; FK506 binding protein 1; FK506 binding protein 12; FK506 binding protein 1A (12kD); FK506 binding protein 1A 12kDa; FK506 binding protein 1A; FK506 binding protein T cell 12 kD; FK506 binding protein, T cell, 12 kD; FK506 binding protein12; FK506-binding protein 1A; FKB1A_HUMAN; FKBP 12; FKBP 1A; FKBP-12; FKBP-1A; FKBP1; FKBP12; FKBP12 Exip3; FKBP12C; fkbp1a; Immunophilin FKBP12; Peptidyl prolyl cis trans isomerase; Peptidyl-prolyl cis-trans isomerase FKBP1A; PKC12; PKCI2; PPIase; PPIase FKBP1A; Protein kinase C inhibitor 2; Rotamase;
Immunogens
- P62942 FKB1A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P62942 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S9 | Phosphorylation | Uniprot | |
| R19 | Methylation | Uniprot | |
| T22 | Phosphorylation | Uniprot | |
| K35 | Acetylation | Uniprot | |
| K35 | Ubiquitination | Uniprot | |
| K36 | Acetylation | Uniprot | |
| K36 | Ubiquitination | Uniprot | |
| K48 | Acetylation | Uniprot | |
| K48 | Ubiquitination | Uniprot | |
| K53 | Acetylation | Uniprot | |
| K53 | Ubiquitination | Uniprot | |
| R58 | Methylation | Uniprot | |
| K74 | Ubiquitination | Uniprot | |
| Y81 | Phosphorylation | Uniprot |
Research Backgrounds
Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Cytoplasm>Cytosol. Sarcoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side.
Interacts with TGFBR1; prevents TGFBR1 phosphorylation by TGFBR2 and stabilizes it in the inactive conformation. Interacts with ACVR1B and SMAD7. Identified in a complex composed of RYR1, PDE4D, PKA, FKBP1A and protein phosphatase 1 (PP1) (By similarity). Interacts directly with RYR2 and RYR3. Interacts with GLMN; rapamycin and FK506 abolish the interaction with GLMN in a dose dependent manner. Interacts directly with RYR1 (By similarity).
Belongs to the FKBP-type PPIase family. FKBP1 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.