Product: Proteasome 20S LMP2 Antibody
Catalog: DF6606
Description: Rabbit polyclonal antibody to Proteasome 20S LMP2
Application: WB IHC
Cited expt.: WB
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus
Mol.Wt.: 23kDa(Observed); 23kD(Calculated).
Uniprot: P28065
RRID: AB_2838568

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Prediction:
Pig(100%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Xenopus(%)
Clonality:
Polyclonal
Specificity:
Proteasome 20S LMP2 Antibody detects endogenous levels of total Proteasome 20S LMP2.
RRID:
AB_2838568
Cite Format: Affinity Biosciences Cat# DF6606, RRID:AB_2838568.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Beta1i; Large multifunctional peptidase 2; Large multifunctional protease 2; LMP 2; LMP2; Low molecular mass protein 2; Macropain chain 7; MGC70470; Multicatalytic endopeptidase complex chain 7; OTTHUMP00000062982; Proteasome (prosome macropain) subunit beta type 9; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2); Proteasome beta 9 subunit; Proteasome catalytic subunit 1i; Proteasome chain 7; Proteasome related gene 2; Proteasome subunit beta 6i; Proteasome subunit beta type 9; Proteasome subunit beta type-9; Proteasome subunit beta-1i; PSB9_HUMAN; PSMB 9; PSMB6i; PSMB9; Really interesting new gene 12 protein; RING 12; RING12; RING12 protein;

Immunogens

Immunogen:

A synthesized peptide derived from human Proteasome 20S LMP2, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Description:
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. [provided by RefSeq, Mar 2010]
Sequence:
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Dog
100
Horse
86
Bovine
86
Sheep
86
Rabbit
86
Xenopus
83
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues.

PTMs:

Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the peptidase T1B family.

Research Fields

· Genetic Information Processing > Folding, sorting and degradation > Proteasome.

References

1). UCHL1 facilitates protein aggregates clearance to enhance neural stem cell activation in spinal cord injury. Cell death & disease, 2023 (PubMed: 37507386) [IF=8.1]

Application: WB    Species: mice    Sample:

Figure 8. Blockade of reactive astrocytes using neutralizing antibodies effectively enhanced endogenous Nestin+ NSC proliferation in SCI mice. (A) Representative images showing the activation of reactive astrocytes (C3/GFAP+) detected by immunofluorescence assay at 7 days post-SCI. Administration of neutralizing antibodies significantly blocked formation of reactive astrocytes after SCI. Enlarged images of the boxed region are shown in the bottom panels. Scale bar (A), 20 μm. Scale bar (a-d), 10 μm. (B) Quantification of C3+ reactive astrocytes in the lesion site at 7 days post-SCI. n=6 independent animals. (C) Proliferation of NSCs around the central canal (transverse plane) and in the lesion center (coronal plane) was evaluated by the detection of Ki-67+ NSCs via immunofluorescence assay. Scale bar, 20 μm. (D) The relative number of Ki67/Nestin+ cells per field were counted. n=6 independent animals. (E-H) Western blotting assay of spinal lysate from SCI mice treated with neutralizing antibodies or IgG isotype control. Representative immunoblot images and quantification of the relative enrichment of proteins were revealed in E and F/G/H. (F/G/H) n=3 independent animals. (B/D/F/G/H) Data are presented as mean ± SEM. p-values (*p

2). IRG1 increases MHC class I level in macrophages through STAT-TAP1 axis depending on NADPH oxidase mediated reactive oxygen species. International Immunopharmacology, 2017 (PubMed: 28477473) [IF=4.8]

Application: WB    Species: human    Sample:

Western blot analysis of proteins expression of TAP1 and PSMB9 in with or without DPI treatment;

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.