ORM1 Antibody - #DF6623
| Product: | ORM1 Antibody |
| Catalog: | DF6623 |
| Description: | Rabbit polyclonal antibody to ORM1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 24kDa, 35-43kDa(Glycosylated); 24kD(Calculated). |
| Uniprot: | P02763 |
| RRID: | AB_2838585 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6623, RRID:AB_2838585.
Fold/Unfold
A1AG1_HUMAN; AGP 1; AGP A; AGP; AGP1; Alpha 1 acid glycoprotein; Alpha-1-acid glycoprotein 1; alpha-1-AGP; Epididymis secretory sperm binding protein Li 153w; glycoprotein, alpha-1-acid, of serum; HEL S 153w; OMD 1; ORM; ORM1; Orosomucoid 1; Orosomucoid-1;
Immunogens
A synthesized peptide derived from human ORM1, corresponding to a region within the internal amino acids.
- P02763 A1AG1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Research Backgrounds
Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.
N-glycosylated. N-glycan heterogeneity at Asn-33: Hex5HexNAc4 (minor), Hex6HexNAc5 (major) and dHex1Hex6HexNAc5 (minor).
Secreted.
Expressed by the liver and secreted in plasma.
Contains a beta-barrel that binds various ligands in its interior.
Belongs to the calycin superfamily. Lipocalin family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.