Product: ORM1 Antibody
Catalog: DF6623
Description: Rabbit polyclonal antibody to ORM1
Application: WB IHC IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 24kDa, 35-43kDa(Glycosylated)(Observed); 24kD(Calculated).
Uniprot: P02763
RRID: AB_2838585

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500, WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Clonality:
Polyclonal
Specificity:
ORM1 Antibody detects endogenous levels of total ORM1.
RRID:
AB_2838585
Cite Format: Affinity Biosciences Cat# DF6623, RRID:AB_2838585.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

A1AG1_HUMAN; AGP 1; AGP A; AGP; AGP1; Alpha 1 acid glycoprotein; Alpha-1-acid glycoprotein 1; alpha-1-AGP; Epididymis secretory sperm binding protein Li 153w; glycoprotein, alpha-1-acid, of serum; HEL S 153w; OMD 1; ORM; ORM1; Orosomucoid 1; Orosomucoid-1;

Immunogens

Immunogen:

A synthesized peptide derived from human ORM1, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P02763 A1AG1_HUMAN:

Expressed by the liver and secreted in plasma.

Description:
Alpha-1-acid glycoprotein 1 (AGP1), also called orosomucoid-1 (ORM1), is a glycoprotein synthesized mostly by hepatocytes and present in human plasma. ORM1 is an acute-phase reactant protein controlled by glucocorticoids, interleukin-1 and interleukin-6, and increase up to 5-50 times upon infection and/or inflammation. Anti-apoptotic effect and role as immunomodulator of ORM have been reported. ORM is an important carrier for synthetic drugs and influences their distribution and availability in the body. This antibody recognizes a band about 44 kDa in human plasma which may be due to the glycosylation of ORM1 or the dimer formation of the protein.
Sequence:
MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES

Research Backgrounds

Function:

Functions as transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain. Also binds synthetic drugs and influences their distribution and availability in the body. Appears to function in modulating the activity of the immune system during the acute-phase reaction.

PTMs:

N-glycosylated. N-glycan heterogeneity at Asn-33: Hex5HexNAc4 (minor), Hex6HexNAc5 (major) and dHex1Hex6HexNAc5 (minor).

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed by the liver and secreted in plasma.

Family&Domains:

Contains a beta-barrel that binds various ligands in its interior.

Belongs to the calycin superfamily. Lipocalin family.

References

1). iTRAQ based proteomic analysis of PM2.5 induced lung damage. RSC Advances, 2019 (PubMed: 35517034) [IF=3.9]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.