VIP Antibody - #DF6627

Product: | VIP Antibody |
Catalog: | DF6627 |
Description: | Rabbit polyclonal antibody to VIP |
Application: | WB IHC IF/ICC |
Cited expt.: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse |
Mol.Wt.: | 19kDa; 19kD(Calculated). |
Uniprot: | P01282 |
RRID: | AB_2838589 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6627, RRID:AB_2838589.
Fold/Unfold
Intestinal peptide PHM27; Peptide histidine methioninamide 27; Vasoactive intestinal polypeptide; VIP;
Immunogens
A synthesized peptide derived from human VIP, corresponding to a region within the internal amino acids.
- P01282 VIP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.
PHM and PHV also cause vasodilation. PHM-27 is a potent agonist of the calcitonin receptor CALCR, with similar efficacy as calcitonin.
Secreted.
Belongs to the glucagon family.
References
Application: WB Species: Rat Sample: lung tissues
Application: WB Species: rat Sample: intestinal
Application: WB Species: Mouse Sample: colon tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.