THPO Antibody - #DF6640
| Product: | THPO Antibody |
| Catalog: | DF6640 |
| Description: | Rabbit polyclonal antibody to THPO |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Horse, Sheep |
| Mol.Wt.: | 38kDa; 38kD(Calculated). |
| Uniprot: | P40225 |
| RRID: | AB_2838602 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6640, RRID:AB_2838602.
Fold/Unfold
C mpl ligand; C-mpl ligand; Megakaryocyte colony stimulating factor; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; Megakaryocyte stimulating factor; MGC163194; MGDF; MKCSF; ML; MPL ligand; MPLLG; Myeloproliferative leukemia virus oncogene ligand; Prepro thrombopoietin; THCYT1; THPO; Thrombopoietin; Thrombopoietin nirs variant 1; TPO; TPO_HUMAN;
Immunogens
A synthesized peptide derived from human THPO, corresponding to a region within the internal amino acids.
- P40225 TPO_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Secreted.
Two-domain structure with an erythropoietin-like N-terminal and a Ser/Pro/Thr-rich C-terminal.
Belongs to the EPO/TPO family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.