SP-C Antibody - #DF6647
| Product: | SP-C Antibody |
| Catalog: | DF6647 |
| Description: | Rabbit polyclonal antibody to SP-C |
| Application: | WB IHC IF/ICC |
| Cited expt.: | WB, IHC, IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine, Horse, Rabbit |
| Mol.Wt.: | 21kDa; 21kD(Calculated). |
| Uniprot: | P11686 |
| RRID: | AB_2838609 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6647, RRID:AB_2838609.
Fold/Unfold
BRICD6; BRICHOS domain containing 6; PSP C; PSPC; PSPC_HUMAN; Pulmonary surfactant apoprotein 2; Pulmonary surfactant apoprotein PSP C; pulmonary surfactant apoprotein-2 SP-C; Pulmonary surfactant associated protein C; Pulmonary surfactant associated proteolipid SPL pVal; Pulmonary surfactant associated proteolipid SPL(Val); Pulmonary surfactant protein SP5; Pulmonary surfactant-associated protein C; Pulmonary surfactant-associated proteolipid SPL(Val); SFTP 2; SFTP2; SFTPC; SFTPC surfactant pulmonary associated protein C; SMDP2; SP 5; SP C; SP-C; SP5; SPC; Surfactant associated protein pulmonary 2; Surfactant protein c; Surfactant proteolipid SPL-pVal; Surfactant pulmonary associated protein C;
Immunogens
A synthesized peptide derived from human SFTPC, corresponding to a region within N-terminal amino acids.
- P11686 PSPC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.
Secreted>Extracellular space>Surface film.
References
Application: WB Species: Mouse Sample: lung tissues
Application: IHC Species: Human Sample:
Application: IF/ICC Species: Mouse Sample: lungs
Application: IF/ICC Species: Mouse Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.