Product: SP-C Antibody
Catalog: DF6647
Description: Rabbit polyclonal antibody to SP-C
Application: WB IHC IF/ICC
Cited expt.: WB, IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Bovine, Horse, Rabbit
Mol.Wt.: 21kDa; 21kD(Calculated).
Uniprot: P11686
RRID: AB_2838609

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Bovine(100%), Horse(100%), Rabbit(92%)
Clonality:
Polyclonal
Specificity:
SP-C Antibody detects endogenous levels of total SP-C.
RRID:
AB_2838609
Cite Format: Affinity Biosciences Cat# DF6647, RRID:AB_2838609.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

BRICD6; BRICHOS domain containing 6; PSP C; PSPC; PSPC_HUMAN; Pulmonary surfactant apoprotein 2; Pulmonary surfactant apoprotein PSP C; pulmonary surfactant apoprotein-2 SP-C; Pulmonary surfactant associated protein C; Pulmonary surfactant associated proteolipid SPL pVal; Pulmonary surfactant associated proteolipid SPL(Val); Pulmonary surfactant protein SP5; Pulmonary surfactant-associated protein C; Pulmonary surfactant-associated proteolipid SPL(Val); SFTP 2; SFTP2; SFTPC; SFTPC surfactant pulmonary associated protein C; SMDP2; SP 5; SP C; SP-C; SP5; SPC; Surfactant associated protein pulmonary 2; Surfactant protein c; Surfactant proteolipid SPL-pVal; Surfactant pulmonary associated protein C;

Immunogens

Immunogen:

A synthesized peptide derived from human SFTPC, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Description:
This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 2, also called pulmonary alveolar proteinosis due to surfactant protein C deficiency, and are associated with interstitial lung disease in older infants, children, and adults. Alternatively spliced transcript variants encoding different protein isoforms have been identified.
Sequence:
MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
100
Rabbit
92
Xenopus
71
Pig
0
Sheep
0
Dog
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Subcellular Location:

Secreted>Extracellular space>Surface film.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

References

1). TRβ activation confers AT2-to-AT1 cell differentiation and anti-fibrosis during lung repair via KLF2 and CEBPA. Nature communications, 2024 (PubMed: 39375377) [IF=16.6]

2). Extracellular Vesicle ITGAM and ITGB2 Mediate Severe Acute Pancreatitis-Related Acute Lung Injury. ACS Nano, 2023 (PubMed: 37022097) [IF=15.8]

3). Itaconic acid regulation of TFEB-mediated autophagy flux alleviates hyperoxia-induced bronchopulmonary dysplasia. Redox biology, 2024 (PubMed: 38554522) [IF=10.7]

4). Impaired autophagy-accelerated senescence of alveolar type II epithelial cells drives pulmonary fibrosis induced by single-walled carbon nanotubes. Journal of Nanobiotechnology, 2023 (PubMed: 36849924) [IF=10.2]

Application: WB    Species: Mouse    Sample: lung tissues

Fig. 1 Single-walled carbon nanotubes (SWCNTs) induced pulmonary fibrosis and senescence of AECIIs in mouse lung tissues. Mice were exposed to 40 μg SWCNT by intratracheal instillation, then lung tissues were collected on days 3, 7 and 28. A Scheme of workflow for evaluation of cellular senescence and pulmonary fibrosis induced by SWCNTs in vivo. B–D Western Blotting analysis of p21 and p16 protein expressions (n = 3) in lung tissues. Contents of TGF-β (E) and PAI-1 (F) in bronchoalveolar lavage fluid (BALF) quantified by ELISA (n = 5). HE staining (G) and Masson’s trichrome staining (H) of mouse lung tissues (200×). I The semiquantitative Ashcroft scores for the severity of pulmonary fibrosis (n = 4). J The hydroxyproline (HYP) level (n = 4) in lung tissues of mice. K Immunohistochemistry (IHC) of COL I expression (n = 5) in lung tissues of mice. L, M The correlation of hydroxyproline contents in mice lung tissues and senescence-associated secretory phenotype (SASP) factors (TGF-β and PAI-1) in BALF. N Immunostaining for p16 (a senescence-related marker) and SP-C (an AECIIs marker) from SWCNTs-exposed lung tissues of mice on day 28 was detected by immunofluorescence (IF) (400×). *P 

5). Novel genome-wide DNA methylation profiling reveals distinct epigenetic landscape, prognostic model and cellular composition of early-stage lung adenocarcinoma. Journal of translational medicine, 2024 (PubMed: 38711158) [IF=7.4]

Application: IHC    Species: Human    Sample:

Fig. 5 UXM analysis identified various cell populations in EM-seq and were verified by Immunohistochemistry (A) Cell proportion score between tumor (red) and normal (green) tissue analyzed by UXM. (B) The cellular composition of each tumor and normal tissue identified by UXM. (C) Representative immunohistochemistry image shows that CD3、CD19、SP-C were highly expressed in NSCLC tumor tissues (C-E); CD31were highly expressed in normal lung tissue (F); CD56 were weakly expressed in normal lung tissue (G).

6). Insights into the mechanism of action of pterostilbene against influenza A virus-induced acute lung injury. Phytomedicine : international journal of phytotherapy and phytopharmacology, 2024 (PubMed: 38583346) [IF=6.7]

7). NLRP3 inflammasome mediates abnormal epithelial regeneration and distal lung remodeling in silica‑induced lung fibrosis. International journal of molecular medicine, 2024 (PubMed: 38240085) [IF=5.7]

8). Establishment of Intestinal Organoid from Rousettus leschenaultii and the Susceptibility to Bat-Associated Viruses, SARS-CoV-2 and Pteropine Orthoreovirus. INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES, 2021 (PubMed: 34639103) [IF=5.6]

9). Triiodothyronine acts on DAO to regulate pulmonary fibrosis progression by facilitating cell senescence through the p53/p21 signaling pathway. Frontiers in pharmacology, 2024 (PubMed: 39323641) [IF=5.6]

Application: IF/ICC    Species: Mouse    Sample: lungs

FIGURE 1. DAO expression was downregulated in IPF lungs and BLM-induced fibrotic mouse lungs. (A) The results of IPF gene sequencing showed that DAO expression was significantly lower in IPF patients than in the controls; (B) A549 cells treated with 0.02 U/mL of BLM for 24 h. Representative immunoblot image of the whole-cell lysate of the DAO protein expression; (C) Representative immunoblot images (up) and densitometry analysis (down) of the Dao protein expression; (D) RT-qPCR analysis of the Dao expression levels in mouse lungs; (E) Representative images of HE staining of mouse lung paraffin sections (Saline control, left; BLM treated, right); (F) Representative images of Masson’s staining of mouse lung paraffin sections (Saline control, left; BLM treated, right); (G) Representative Dao and Sp-c immunofluorescence staining images of mouse lung paraffin sections showing that Dao expression was downregulated and Sp-c expression was upregulated. *p < 0.05, **p < 0.01.

10). Rosmarinic acid treatment protects against lethal H1N1 virus-mediated inflammation and lung injury by promoting activation of the h-PGDS-PGD2-HO-1 signal axis. Chinese medicine, 2023 (PubMed: 37891648) [IF=5.3]

Application: IF/ICC    Species: Mouse    Sample:

Fig. 2 Effects of RosA on the H1N1 virus-triggered pro-inflammatory response. A Representative immunofluorescence images of IL-6, IL-8 (pink) and TNF-α, MCP-1 (red) in lung SpC+ (green) alveolar epithelial cells. B Quantitative analysis of fluorescence intensities for IL-6, TNF-α, IL-8 and MCP-1 in SpC+ alveolar epithelial cells. C Levels of pro-inflammatory mediators (IL-6, MCP-1, RANTES and TNF-α) in the lung homogenates were determined by Luminex assay. D Levels of pro-inflammatory mediators (IL-6, IL-8, IP-10, MCP-1, RANTES and TNF-α) were determined by Luminex assay.

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.