Product: IL24 Antibody
Catalog: DF6672
Description: Rabbit polyclonal antibody to IL24
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 24kDa(Observed); 24kD(Calculated).
Uniprot: Q13007
RRID: AB_2838634

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Specificity:
IL24 Antibody detects endogenous levels of total IL24.
RRID:
AB_2838634
Cite Format: Affinity Biosciences Cat# DF6672, RRID:AB_2838634.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C49A; FISP; IL 24; IL 4 induced secreted protein; IL-24; IL10B; Il24; IL24_HUMAN; interleukin 24; Interleukin-24; MDA-7; MDA7; Melanocyte associated Mda 7; Melanoma differentiation association protein 7; Melanoma differentiation-associated gene 7 protein; Mob5; ST16; Suppression of tumorigenicity 16 (melanoma differentiation); Suppression of tumorigenicity 16; Suppression of tumorigenicity 16 protein;

Immunogens

Immunogen:

A synthesized peptide derived from human IL24, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q13007 IL24_HUMAN:

Up-regulated in melanoma cells induced to terminally differentiate.

Description:
This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Sequence:
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Research Backgrounds

Function:

Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation.

PTMs:

Ubiquitination at Lys-122 promotes proteasomal degradation.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Up-regulated in melanoma cells induced to terminally differentiate.

Family&Domains:

Belongs to the IL-10 family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.