Peroxiredoxin 2 Antibody - #DF6691
Product: | Peroxiredoxin 2 Antibody |
Catalog: | DF6691 |
Description: | Rabbit polyclonal antibody to Peroxiredoxin 2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Horse, Sheep, Dog, Xenopus |
Mol.Wt.: | 22kDa; 22kD(Calculated). |
Uniprot: | P32119 |
RRID: | AB_2838653 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6691, RRID:AB_2838653.
Fold/Unfold
Epididymis secretory sperm binding protein Li 2a; HEL S 2a; MGC4104; Natural killer cell enhancing factor B; Natural killer cell-enhancing factor B; Natural Killer Enhancing Factor B; NKEF B; NKEF-B; NKEFB; Peroxiredoxin-2; PRDX 2; PRDX2; PRDX2_HUMAN; PrP; PRX2; PRXII; PTX1; TDPX1; Thiol Specific Antioxidant 1; Thiol specific antioxidant protein; Thiol-specific antioxidant protein; Thioredoxin Dependent Peroxide Reductase 1; Thioredoxin peroxidase 1; Thioredoxin-dependent peroxide reductase 1; Torin; TPX1; TSA;
Immunogens
- P32119 PRDX2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P32119 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
S3 | Phosphorylation | Uniprot | |
K10 | Ubiquitination | Uniprot | |
K16 | Acetylation | Uniprot | |
K16 | Ubiquitination | Uniprot | |
T18 | O-Glycosylation | Uniprot | |
T18 | Phosphorylation | Uniprot | |
K26 | Acetylation | Uniprot | |
K26 | Ubiquitination | Uniprot | |
K29 | Ubiquitination | Uniprot | |
S31 | Phosphorylation | Uniprot | |
K34 | Acetylation | Uniprot | |
T89 | Phosphorylation | Uniprot | |
K92 | Ubiquitination | Uniprot | |
R110 | Methylation | Uniprot | |
S112 | O-Glycosylation | Uniprot | |
S112 | Phosphorylation | Uniprot | |
Y115 | Phosphorylation | Uniprot | |
K119 | Acetylation | Uniprot | |
K119 | Ubiquitination | Uniprot | |
T120 | Phosphorylation | Uniprot | |
Y126 | Phosphorylation | Uniprot | |
R127 | Methylation | Uniprot | |
K135 | Acetylation | Uniprot | |
K135 | Ubiquitination | Uniprot | |
T142 | Phosphorylation | Uniprot | |
R150 | Methylation | Uniprot | |
S151 | Phosphorylation | Uniprot | |
R157 | Methylation | Uniprot | |
K177 | Methylation | Uniprot | |
K177 | Ubiquitination | Uniprot | |
T182 | Phosphorylation | Uniprot | |
S190 | Phosphorylation | Uniprot | |
K191 | Sumoylation | Uniprot | |
K191 | Ubiquitination | Uniprot | |
Y193 | Phosphorylation | Uniprot | |
S195 | Phosphorylation | Uniprot |
Research Backgrounds
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).
The enzyme can be inactivated by further oxidation of the cysteine sulfenic acid (C(P)-SOH) to sulphinic acid (C(P)-SO2H) instead of its condensation to a disulfide bond. It can be reactivated by forming a transient disulfide bond with sulfiredoxin SRXN1, which reduces the cysteine sulfinic acid in an ATP- and Mg-dependent manner.
Cytoplasm.
Homodimer; disulfide-linked, upon oxidation. 5 homodimers assemble to form a ring-like decamer. Interacts with TIPIN.
Belongs to the peroxiredoxin family. AhpC/Prx1 subfamily.
References
Application: WB Species: Human Sample: Wound granulation tissues
Application: WB Species: Human Sample: Wound granulation tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.