Product: Claudin 5 Antibody
Catalog: AF0130
Description: Rabbit polyclonal antibody to Claudin 5
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Rabbit
Mol.Wt.: 23kDa; 23kD(Calculated).
Uniprot: O00501
RRID: AB_2833314

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC 1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(89%), Rabbit(89%)
Clonality:
Polyclonal
Specificity:
Claudin 5 Antibody detects endogenous levels of total Claudin 5.
RRID:
AB_2833314
Cite Format: Affinity Biosciences Cat# AF0130, RRID:AB_2833314.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Androgen withdrawal and apoptosis induced protein RVP1 like; AWAL; BEC 1; BEC1; Claudin 5 (transmembrane protein deleted in velocardiofacial syndrome); Claudin-5; Claudin5; CLD5_HUMAN; CLDN 5; Cldn5; CPETR L1; CPETRL 1; CPETRL1; TMDVCF; TMVCF; Transmembrane protein deleted in VCFS; Transmembrane protein deleted in velocardiofacial syndrome;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Description:
claudin 5 Plays a major role in tight junction-specific obliteration of the intercellular space. Belongs to the claudin family. Directly interacts with TJP1/ZO-1, TJP2/ZO-2 and TJP3/ZO- 3. Interacts with MPDZ.
Sequence:
MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
89
Rabbit
89
Chicken
78
Xenopus
75
Horse
0
Sheep
0
Dog
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - O00501 As Substrate

Site PTM Type Enzyme
S86 Phosphorylation
Y148 Phosphorylation
S155 Phosphorylation
T207 Phosphorylation
T209 Phosphorylation
Y212 Phosphorylation
Y217 Phosphorylation

Research Backgrounds

Function:

Plays a major role in tight junction-specific obliteration of the intercellular space.

Subcellular Location:

Cell junction>Tight junction. Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Directly interacts with TJP1/ZO-1, TJP2/ZO-2 and TJP3/ZO-3. Interacts with MPDZ (By similarity).

Family&Domains:

Belongs to the claudin family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Human Diseases > Infectious diseases: Viral > Hepatitis C.

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

References

1). Yang L et al. Engagement of circular RNA HECW2 in the nonautophagic role of ATG5 implicated in the endothelial-mesenchymal transition. Autophagy 2018;14(3):404-418 (PubMed: 29260931) [IF=13.3]

Application: WB    Species: human    Sample: HBMECs

Figure 3|Role of ATG5 in LPS-induced EndoMT. Scale bar: 5 μm. Mice were administered LPS (0.83 mg/kg) once per day for 7 d. n=6 animals/group. *P<0.05,**P<0.01, ***P<0.001 versus saline group using the Mann-Whitney test. Transfection of HBMECs with siRNA ATG5 significantly inhibited the decreases in the TJP expression levels and the increases in the mesenchymal cell marker expression .

2). Zhang Y et al. Activation of Sigma-1 Receptor Enhanced Pericyte Survival via the Interplay Between Apoptosis and Autophagy: Implications for Blood-Brain Barrier Integrity in Stroke. Translational Stroke Research 2019 Jul 9 (PubMed: 31290080) [IF=6.9]

Application: WB    Species: mouse    Sample: brain

Fig. 1| Knockdown of σ-1R aggravated cerebral ischemia-induced injury in pMCAO mice.h, i The decrease in TJP expression in the ipsilateral side of the brain observed at 24 h after pMCAO surgery was aggravated in σ-1R KO mice. TJP expression levels were determined via western blot analysis (h) and quantified through densitometric analysis.

3). Zhao-Yang Wang et al. Axl deficiency promotes the neuroinvasion of Japanese encephalitis virus by enhancing IL-1α production from pyroptotic macrophages. Journal of Virology 2020 Jul 1;JVI.00602-20. (PubMed: 32611752) [IF=5.4]

Application: IF/ICC    Species: mouse    Sample: brains

Fig.9. |Effects of IL-1α alone on BBB permeability and tight junction integrity.(D) IF staining of claudin-5, occludin, and ZO-1 (red), CD31 (microvascular endothelial cell marker, green), and DAPI (nucleus, blue), scale bar=20 μm.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.