CD151 Antibody - #DF6699
| Product: | CD151 Antibody |
| Catalog: | DF6699 |
| Description: | Rabbit polyclonal antibody to CD151 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Bovine, Horse, Dog, Xenopus |
| Mol.Wt.: | 28kDa; 28kD(Calculated). |
| Uniprot: | P48509 |
| RRID: | AB_2838661 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6699, RRID:AB_2838661.
Fold/Unfold
CD151; CD151 antigen; CD151 molecule (Raph blood group); CD151 molecule; CD151_HUMAN; GP27; hemidesmosomal tetraspanin CD151; Membrane glycoprotein SFA-1; MER2; PETA-3; PETA3; Platelet endothelial tetraspan antigen 3; platelet surface glycoprotein gp27; Platelet-endothelial cell tetraspan antigen 3; Platelet-endothelial tetraspan antigen 3; RAPH; Red blood cell antigen MER2; SFA 1; SFA1; Tetraspanin-24; Tspan-24; TSPAN24;
Immunogens
A synthesized peptide derived from human CD151, corresponding to a region within N-terminal amino acids.
Expressed in a variety of tissues including vascular endothelium and epidermis. Expressed on erythroid cells, with a higher level of expression in erythroid precursors than on mature erythrocytes.
- P48509 CD151_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Essential for the proper assembly of the glomerular and tubular basement membranes in kidney.
(Microbial infection) Plays a role in human papillomavirus 16/HPV-16 endocytosis upon binding to cell surface receptor.
Membrane>Multi-pass membrane protein.
Expressed in a variety of tissues including vascular endothelium and epidermis. Expressed on erythroid cells, with a higher level of expression in erythroid precursors than on mature erythrocytes.
Belongs to the tetraspanin (TM4SF) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.