Product: RAB27A Antibody
Catalog: DF6702
Description: Rabbit polyclonal antibody to RAB27A
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Horse, Sheep, Chicken
Mol.Wt.: 24kDa; 25kD(Calculated).
Uniprot: P51159
RRID: AB_2838664

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Horse(90%), Sheep(82%), Chicken(82%)
Clonality:
Polyclonal
Specificity:
RAB27A Antibody detects endogenous levels of total RAB27A.
RRID:
AB_2838664
Cite Format: Affinity Biosciences Cat# DF6702, RRID:AB_2838664.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

GS2; GTP-binding protein Ram; HsT18676; MGC117246; Mutant Ras related protein Rab-27A; Rab-27; RAB-27A; RAB27; RAB27A; RAB27A member RAS oncogene family; RAM; Ras-related protein Rab-27A; Ras-related protein Rab27A; RB27A_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human RAB27A, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P51159 RB27A_HUMAN:

Found in all the examined tissues except in brain. Low expression was found in thymus, kidney, muscle and placenta. Detected in melanocytes, and in most tumor cell lines examined. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells.

Description:
The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.
Sequence:
MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
90
Sheep
82
Chicken
82
Pig
73
Bovine
73
Dog
73
Xenopus
73
Rabbit
73
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate homeostasis of late endocytic pathway, including endosomal positioning, maturation and secretion. Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse.

Subcellular Location:

Membrane>Lipid-anchor. Melanosome. Late endosome. Lysosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV (PubMed:12643545, PubMed:17081065). Localizes to endosomal exocytic vesicles (PubMed:17237785).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Found in all the examined tissues except in brain. Low expression was found in thymus, kidney, muscle and placenta. Detected in melanocytes, and in most tumor cell lines examined. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells.

Family&Domains:

Belongs to the small GTPase superfamily. Rab family.

References

1). Circulating tumor cells shielded with extracellular vesicle-derived CD45 evade T cell attack to enable metastasis. Signal transduction and targeted therapy, 2024 (PubMed: 38575583) [IF=40.8]

Application: WB    Species: Human    Sample:

Fig. 4 CD45 overexpressing tumor cells were resistant to T cell killing. a T cell killing effect was tested in DLD1 cells that had been indirectly pre-cocultured with Jurkat cells. For the evaluation of T cell killing, PBMCs (effector; E) were incubated with CD45− or CD45+ DLD1 cells (tumor cell; T) at a E:T ratio of 2:1. b T cell cytotoxicity assay of DLD1 cells (preincubated with PBS or Jurkat cell-derived EVs) in co-culture with PBMCs after the addition of OKT3 (1 μg/mL) at various E:T ratios. The images on the left are representative images of survived DLD1 cells stained with crystal violet, and the graph on the right is a line graph showing the relative intensity of survived DLD1 cells. c, d Immunoblot analysis showing CD45 expression after CRISPR Cas9 knockout of PTPRC or RAB27A knockdown in Jurkat cells. e Bar graph showing EVs-derived CD45 levels from supernatant of Jurkat cells by ELISA assay. f T cell cytotoxicity assay of DLD1 cells (preincubated with PBS or Jurkat cell-derived EVs (EVs from Jurkat-Ctrl, Jurkat-sgCD45 or Jurkat-shRAB27A cells) in co-culture with PBMCs after the addition of OKT3 (1 μg/mL) at different E:T ratios. g Schematic diagram showing the different CD45 isoforms tested in the study. h Immunoblot analysis of DLD1 cells overexpressing different CD45 isoforms. i Immunofluorescence imaging of membrane CD45-GFP on DLD1 cells. Scale bar = 5 μm. j Comparison of CD45 expression on DLD1 cells and Jurkat cells. k Proliferation assay of DLD1 cells overexpressing different isoforms of CD45. l, m T cell cytotoxicity assay of DLD1 cells with or without CD45 overexpression co-cultured with PBMCs in the presence of pre-coated OKT3 (1 μg/mL) at different E:T ratios. n–p Quantitative analysis of IFN-γ, TNF-α, and IL-2 secretion in the co-culture system of T cell cytotoxicity assay with DLD1 cells. q Proliferation of carboxyfluorescein succinimidyl ester (CFSE)-labeled CD8+ T cells in the co-culture system of T cell cytotoxicity assay with DLD1 cells. r Immunoblot analysis of Caco2 cells overexpressing different CD45 isoforms. s, t T cell cytotoxicity assay of Caco2 cells with or without CD45 overexpression co-cultured with PBMCs in the presence of pre-coated OKT3 (1 μg/mL) at different ratios. u–w Quantitative analysis of IFN-γ, TNF-α, and IL-2 secretion in the co-culture system of T cell cytotoxicity assay with Caco2 cells. x Proliferation of CFSE-labeled CD8+ T cells in the co-culture system of T cell cytotoxicity assay with Caco2 cells. y NK cell sorting strategy from WBCs. z Lysis percentage of NK cell killing Caco2 cells with density diluted NK cells at NK: Tumor ratios of 80: 8 to 5: 8. All bar graph data are presented as means ± SEM. *P 

2). Targeted Blockage of Pathological Extracellular Vesicles and Particles From Fibroblast-Like Synoviocytes for Osteoarthritis Relief: Proteomic Analysis and Cellular Effect. Journal of extracellular vesicles, 2025 (PubMed: 40919882) [IF=16.0]

Application: IF/ICC    Species: Mouse    Sample:

FIGURE 6 Intra-articular injection of FLS-targeting AAV for delivering Rab27a-shRNA to specifically reduce EVP secretion. (A) Rab27a expression levels in FLSs after transfection with control shRNA and Rab27a knockdown shRNA. (B, C) EVP size distribution and quantification after transfection with control shRNA and Rab27a knockdown shRNA. ** Indicates p < 0.01, versus the indicated groups, student’s t-test. (D) Representative Western blot images for positive and negative surface markers of EVPs at equal concentration after shRNA transfection. (E) Schematic diagram of constructing a virus targeting FLS to inhibit Rab27a for intra-articular injection. The synovium-affinity peptide HAP-1 is fused with the AAV9 viral capsid viral protein 2 (VP2), and the AAV9 vector is designed to simultaneously carry the gene encoding the mScarlet fluorescent protein and an expression cassette for shRNA. (F) Representative images of mScarlet fluorescence in the synovium and cartilage regions of mouse knee joints. Scale bar = 200 µm and 100 µm separately. (G) Representative images of mScarlet fluorescence in sections of multiple mouse organs. Scale bar = 200 µm. (H) Representative images and quantitative results of RAB27A expression in the synovial region after intra-articular AAV injection. ** Indicates p < 0.01, versus the indicated groups, two-way ANOVA.

3). Icariin-Enhanced Osteoclast-Derived Exosomes Promote Repair of Infected Bone Defects by Regulating Osteoclast and Osteoblast Communication. International journal of nanomedicine, 2024 (PubMed: 39588260) [IF=6.6]

Application: IF/ICC    Species: Rat    Sample: Osteoclasts

Figure 2 Icariin regulated MITF/Rab27A in osteoclasts. (A) Molecular docking between icariin and MITF. In the 3D plot, the blue solid line represents the hydrogen bond, the gray dotted line represents the hydrophobic force, in the 2D plot, the pink solid line represents the hydrophobic force, and the green and light green dotted lines both represent the hydrogen bond. (B) Representative images of immunofluorescence staining of MITF (green). The nucleus was stained with DAPI, and cytoskeleton were stained with phalloidin. (C) The histogram represents the relative positive expression of MITF in each group. **P < 0.01 compared with the control groups. (D) Representative images of immunofluorescence staining of Rab27A (green). The nucleus was stained with DAPI, and cytoskeleton were stained with phalloidin. (E) The colocalization Pearson correlation coefficient (PCC) of Rab27A and cytoskeleton. Each dot represents the PCC per view under the microscope, and mean is indicated in black dotted lines. *P < 0.05, **P < 0.01 compared with the control groups. (F and G) Western Blot was used to test the protein expressions of MITF and Rab27A in osteoclasts treating with icariin, *P < 0.05, compared with the control groups.

Application: WB    Species: Rat    Sample: Osteoclasts

Figure 2 Icariin regulated MITF/Rab27A in osteoclasts. (A) Molecular docking between icariin and MITF. In the 3D plot, the blue solid line represents the hydrogen bond, the gray dotted line represents the hydrophobic force, in the 2D plot, the pink solid line represents the hydrophobic force, and the green and light green dotted lines both represent the hydrogen bond. (B) Representative images of immunofluorescence staining of MITF (green). The nucleus was stained with DAPI, and cytoskeleton were stained with phalloidin. (C) The histogram represents the relative positive expression of MITF in each group. **P < 0.01 compared with the control groups. (D) Representative images of immunofluorescence staining of Rab27A (green). The nucleus was stained with DAPI, and cytoskeleton were stained with phalloidin. (E) The colocalization Pearson correlation coefficient (PCC) of Rab27A and cytoskeleton. Each dot represents the PCC per view under the microscope, and mean is indicated in black dotted lines. *P < 0.05, **P < 0.01 compared with the control groups. (F and G) Western Blot was used to test the protein expressions of MITF and Rab27A in osteoclasts treating with icariin, *P < 0.05, compared with the control groups.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.