RAB27A Antibody - #DF6702

Product: | RAB27A Antibody |
Catalog: | DF6702 |
Description: | Rabbit polyclonal antibody to RAB27A |
Application: | WB IHC IF/ICC |
Cited expt.: | WB, IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Horse, Sheep, Chicken |
Mol.Wt.: | 24kDa; 25kD(Calculated). |
Uniprot: | P51159 |
RRID: | AB_2838664 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6702, RRID:AB_2838664.
Fold/Unfold
GS2; GTP-binding protein Ram; HsT18676; MGC117246; Mutant Ras related protein Rab-27A; Rab-27; RAB-27A; RAB27; RAB27A; RAB27A member RAS oncogene family; RAM; Ras-related protein Rab-27A; Ras-related protein Rab27A; RB27A_HUMAN;
Immunogens
A synthesized peptide derived from human RAB27A, corresponding to a region within C-terminal amino acids.
Found in all the examined tissues except in brain. Low expression was found in thymus, kidney, muscle and placenta. Detected in melanocytes, and in most tumor cell lines examined. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells.
- P51159 RB27A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate homeostasis of late endocytic pathway, including endosomal positioning, maturation and secretion. Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse.
Membrane>Lipid-anchor. Melanosome. Late endosome. Lysosome.
Note: Identified by mass spectrometry in melanosome fractions from stage I to stage IV (PubMed:12643545, PubMed:17081065). Localizes to endosomal exocytic vesicles (PubMed:17237785).
Found in all the examined tissues except in brain. Low expression was found in thymus, kidney, muscle and placenta. Detected in melanocytes, and in most tumor cell lines examined. Expressed in cytotoxic T-lymphocytes (CTL) and mast cells.
Belongs to the small GTPase superfamily. Rab family.
References
Application: WB Species: Human Sample:
Application: IF/ICC Species: Mouse Sample:
Application: IF/ICC Species: Rat Sample: Osteoclasts
Application: WB Species: Rat Sample: Osteoclasts
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.