UBE2D1 Antibody - #DF6715
| Product: | UBE2D1 Antibody |
| Catalog: | DF6715 |
| Description: | Rabbit polyclonal antibody to UBE2D1 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 17kDa,25kD(UBE2D1-Ub); 17kD(Calculated). |
| Uniprot: | P51668 |
| RRID: | AB_2838677 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6715, RRID:AB_2838677.
Fold/Unfold
E2(17)KB1; SFT; Stimulator of Fe transport; UB2D1_HUMAN; UBC 4/5; UBC4/5; UBC4/5 homolog; UBC4/5, S. cerevisiae, homolog of; UBCH 5; UBCH 5A; UbcH5; UBCH5A; Ube2d1; Ubiquitin carrier protein; Ubiquitin carrier protein D1; Ubiquitin conjugating enzyme E2 17 kDa 1; Ubiquitin conjugating enzyme E2 D1; Ubiquitin conjugating enzyme E2D 1 (UBC4/5 homolog yeast); Ubiquitin conjugating enzyme E2D 1; Ubiquitin conjugating enzyme UBCH5A; Ubiquitin protein ligase D1; Ubiquitin-conjugating enzyme E2 D1; Ubiquitin-conjugating enzyme E2(17)KB 1; Ubiquitin-conjugating enzyme E2-17 kDa 1; Ubiquitin-protein ligase D1;
Immunogens
A synthesized peptide derived from human UBE2D1, corresponding to a region within C-terminal amino acids.
Ubiquitous. Up-regulated in livers of iron-overloaded patients with hereditary hemochromatosis.
- P51668 UB2D1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6 and TRIM63/MURF1. Ubiquitinates STUB1-associated HSP90AB1 in vitro. Lacks inherent specificity for any particular lysine residue of ubiquitin. Essential for viral activation of IRF3. Mediates polyubiquitination of CYP3A4.
Autoubiquitinated in vitro.
Cytoplasm.
Ubiquitous. Up-regulated in livers of iron-overloaded patients with hereditary hemochromatosis.
Belongs to the ubiquitin-conjugating enzyme family.
Research Fields
· Genetic Information Processing > Folding, sorting and degradation > Ubiquitin mediated proteolysis. (View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Protein processing in endoplasmic reticulum. (View pathway)
References
Application: IHC Species: human Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.