MSMB Antibody - #DF6720
Product: | MSMB Antibody |
Catalog: | DF6720 |
Description: | Rabbit polyclonal antibody to MSMB |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 13kDa; 13kD(Calculated). |
Uniprot: | P08118 |
RRID: | AB_2838682 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6720, RRID:AB_2838682.
Fold/Unfold
Beta microseminoprotein [Precursor]; Beta-microseminoprotein; HPC 13; HPC13; IGBF; Immunoglobulin binding factor; Immunoglobulin-binding factor; microseminoprotein beta; Msmb; MSMB_HUMAN; MSP; MSPB; PN 44; PN44; Prostate secreted seminal plasma protein; Prostate secretory protein of 94 amino acids; Prostate secretory protein PSP94; PRPS; PRSP; PSP 57; PSP; PSP-94; PSP57; PSP94; Seminal plasma beta inhibin; Seminal plasma beta-inhibin;
Immunogens
A synthesized peptide derived from human MSMB, corresponding to a region within the internal amino acids.
Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney and bladder.
- P08118 MSMB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Research Backgrounds
Secreted.
Note: Sperm surface.
Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney and bladder.
Belongs to the beta-microseminoprotein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.