Product: TNFRSF14 Antibody
Catalog: DF6724
Description: Rabbit polyclonal antibody to TNFRSF14
Application: WB IHC
Reactivity: Human, Rat
Mol.Wt.: 30kDa; 30kD(Calculated).
Uniprot: Q92956
RRID: AB_2838686

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Rat
Clonality:
Polyclonal
Specificity:
TNFRSF14 Antibody detects endogenous levels of total TNFRSF14.
RRID:
AB_2838686
Cite Format: Affinity Biosciences Cat# DF6724, RRID:AB_2838686.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

HVEML; ATAR; CD270; CD40 like protein precursor; Herpes virus entry mediator A; Herpesvirus entry mediator A; Herpesvirus entry mediator; Herpesvirus entry mediator ligand; HveA; HVEM; HVEM L; LIGHT; LIGHTR; TNFRSF14; TNFSF 14; TNR14_HUMAN; TR2; Tumor necrosis factor receptor like gene2; Tumor necrosis factor receptor superfamily member 14; Tumor necrosis factor receptor superfamily member 14 precursor; Tumor necrosis factor receptor-like 2;

Immunogens

Immunogen:

A synthesized peptide derived from human TNFRSF14, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q92956 TNR14_HUMAN:

Widely expressed, with the highest expression in lung, spleen and thymus. Expressed in a subpopulation of B cells and monocytes (PubMed:18193050). Expressed in naive T cells (PubMed:19915044).

Description:
The mammalian tumor necrosis factor receptor (TNFR) family consists of 10 cell-surface proteins that regulate development and homeostasis of the immune system. Member 14 of TNFR (TNFRSF14, also named as TR2, ATAR, HVEA, HVEM, LIGHTR) was also identified as a mediator of herpesvirus entry into mammalian cells. The cytoplasmic region of TNFRSF14 bound to several members of the TNFR-associated factor (TRAF) family, namely TRAF1, TRAF2, TRAF3, and TRAF5. Transient transfection into human 293 cells caused marked activation of nuclear factor- B (NF- B), a transcriptional regulator of multiple immunomodulatory and inflammatory genes.
Sequence:
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH

Research Backgrounds

Function:

Receptor for four distinct ligands: The TNF superfamily members TNFSF14/LIGHT and homotrimeric LTA/lymphotoxin-alpha and the immunoglobulin superfamily members BTLA and CD160, altogether defining a complex stimulatory and inhibitory signaling network. Signals via the TRAF2-TRAF3 E3 ligase pathway to promote immune cell survival and differentiation. Participates in bidirectional cell-cell contact signaling between antigen presenting cells and lymphocytes. In response to ligation of TNFSF14/LIGHT, delivers costimulatory signals to T cells, promoting cell proliferation and effector functions. Interacts with CD160 on NK cells, enhancing IFNG production and anti-tumor immune response. In the context of bacterial infection, acts as a signaling receptor on epithelial cells for CD160 from intraepithelial lymphocytes, triggering the production of antimicrobial proteins and proinflammatory cytokines (By similarity). Upon binding to CD160 on activated CD4+ T cells, downregulates CD28 costimulatory signaling, restricting memory and alloantigen-specific immune response. May interact in cis (on the same cell) or in trans (on other cells) with BTLA (By similarity). In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells (By similarity).

(Microbial infection) Acts as a receptor for Herpes simplex virus 1/HHV-1.

(Microbial infection) Acts as a receptor for Herpes simplex virus 2/HHV-2.

PTMs:

N-glycosylated.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Widely expressed, with the highest expression in lung, spleen and thymus. Expressed in a subpopulation of B cells and monocytes. Expressed in naive T cells.

Family&Domains:

The cysteine rich domain I (CRD1/TNFR-Cys 1) is required for interaction with BY55 and BTLA.

Belongs to the tumor necrosis factor receptor superfamily.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.