EPCAM Antibody - #BF0159

(1)   (3)  
Product: EPCAM Antibody
Catalog: BF0159
Description: Mouse monoclonal antibody to EPCAM
Application: WB IHC ELISA
Cited expt.:
Reactivity: Human
Mol.Wt.: 35kDa; 35kD(Calculated).
Uniprot: P16422
RRID: AB_2833813

View similar products>>

   Size Price Inventory
 50ul $250 In stock
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
ELISA 1:10000, WB 1:500-1:2000, IHC 1:200-1:1000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFB1789]
Specificity:
EPCAM antibody detects endogenous levels of total EPCAM.
RRID:
AB_2833813
Cite Format: Affinity Biosciences Cat# BF0159, RRID:AB_2833813.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

17 1A; 323/A3; Adenocarcinoma associated antigen; Adenocarcinoma-associated antigen; Antigen identified by monoclonal antibody AUA1; AUA1; CD326; CD326 antigen; Cell surface glycoprotein Trop 1; Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-1; CO 17A; CO17 1A; CO17A; DIAR5; EGP 2; EGP; EGP2; EGP314; EGP40; Ep CAM; Ep-CAM; EPCAM; EPCAM_HUMAN; EpCAM1; Epithelial cell adhesion molecule; Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD); Epithelial cell surface antigen; Epithelial cellular adhesion molecule; Epithelial glycoprotein 1; Epithelial glycoprotein 314; Epithelial glycoprotein; ESA; GA733 1; GA733 2; GA733-2; gastrointestinal tumor-associated antigen 2, 35-KD glycoprotein; gp4; hEGP 2; hEGP314; HNPCC8; Human epithelial glycoprotein 2; KS 1/4 antigen; KS1/4; KSA; Ly74; Lymphocyte antigen 74; M1S 1; M1S2; M4S1; Major gastrointestinal tumor associated protein GA733 2; Major gastrointestinal tumor-associated protein GA733-2; mEGP314; Membrane component chromosome 4 surface marker (35kD glycoprotein); Membrane component, chromosome 4, surface marker 1; Membrane component, chromosome 4, surface marker; MIC18; MK 1; Protein 289A; TACD1; TACSTD1; TROP1; Tumor associated calcium signal transducer 1; Tumor associated calcium signal transducer 2 precursor; Tumor-associated calcium signal transducer 1;

Immunogens

Immunogen:

Purified recombinant fragment of human EPCAM expressed in E. Coli.

Uniprot:

P16422(EPCAM_HUMAN) >>Visit HPA database.

Gene(ID):
EPCAM(4072)
Expression:
P16422 EPCAM_HUMAN:

Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.

Description:
This 9-exon gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas.
Sequence:
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA

Research Backgrounds

Function:

May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

PTMs:

Hyperglycosylated in carcinoma tissue as compared with autologous normal epithelia. Glycosylation at Asn-198 is crucial for protein stability.

Subcellular Location:

Lateral cell membrane>Single-pass type I membrane protein. Cell junction>Tight junction.
Note: Colocalizes with CLDN7 at the lateral cell membrane and tight junction.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.

Family&Domains:

Belongs to the EPCAM family.

References

1). Single-cell RNA sequencing reveals small extracellular vesicles derived from malignant cells that contribute to angiogenesis in human breast cancers. Journal of translational medicine, 2023 (PubMed: 37626402) [IF=7.4]

Application: IF/ICC    Species: human    Sample: breast cancers

Fig. 3 From: Single-cell RNA sequencing reveals small extracellular vesicles derived from malignant cells that contribute to angiogenesis in human breast cancers Differences between subsets of malignant cells with and without angiogenesis. A Single cell map showing eleven malignant cell subclusters. B UMAP plot of 14,151 cells from eight patient samples. C Tumor cell subclusters composition according to the patients. D Scatter plot showing the distribution of tumor cells in angiogenic and non-angiogenic breast cancer. E–F Violin plots and UMAP figures showing malignant cell-related markers and their distribution in malignant cell subgroups. G UMAP series of single-cell maps of BRCA_AGR3, BRCA_SRGN and BRCA_PPP1R1B. H Immunofluorescence imaging of AGR3, SRGN, PPP1R1B (green) and EpCAM (red) in three breast cancer tissue samples. The nuclei were counterstained with DAPI. Scale bar, 20 µm. I Representative images of the IHC of key genes between breast cancer and normal breast tissues available in the HPA database. J Volcano plot showing differences in gene expression genes in eleven tumor cell subclusters

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.