EIF5A1 Antibody - #DF6754
| Product: | EIF5A1 Antibody |
| Catalog: | DF6754 |
| Description: | Rabbit polyclonal antibody to EIF5A1 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 16kDa; 17kD(Calculated). |
| Uniprot: | P63241 |
| RRID: | AB_2838716 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6754, RRID:AB_2838716.
Fold/Unfold
eIF 4D; eIF 5A 1; EIF 5A; eIF 5A1; eIF-4D; eIF-5A; eIF-5A-1; eIF-5A1; eIF4D; eif5a; EIF5A1; eIF5AI; Eukaryotic initiation factor 5A; Eukaryotic initiation factor 5A isoform 1; Eukaryotic translation initiation factor 5A 1; Eukaryotic translation initiation factor 5A; Eukaryotic translation initiation factor 5A-1; IF5A1_HUMAN; MGC104255; MGC99547; Rev binding factor; Rev-binding factor; uORF A; uORF;
Immunogens
A synthesized peptide derived from human EIF5A1 corresponding to a region within the internal amino acids.
Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level).
- P63241 IF5A1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts.
Acetylated. Deacetylated by SIRT2.
eIF-5A seems to be the only eukaryotic protein to have a hypusine residue which is a post-translational modification of a lysine by the addition of a butylamino group (from spermidine).
Cytoplasm. Nucleus. Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side. Nucleus>Nuclear pore complex.
Note: Hypusine modification promotes the nuclear export and cytoplasmic localization and there was a dynamic shift in the localization from predominantly cytoplasmic to primarily nuclear under apoptotic inducing conditions.
Expressed in umbilical vein endothelial cells and several cancer cell lines (at protein level).
Belongs to the eIF-5A family.
References
Application: IHC Species: Human Sample: healthy cartilage tissues
Application: IHC Species: human Sample: cartilage
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.