TPSAB1 Antibody - #DF6758
| Product: | TPSAB1 Antibody |
| Catalog: | DF6758 |
| Description: | Rabbit polyclonal antibody to TPSAB1 |
| Application: | WB IHC IF/ICC |
| Cited expt.: | IHC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 31kDa; 31kD(Calculated). |
| Uniprot: | Q15661 |
| RRID: | AB_2838720 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6758, RRID:AB_2838720.
Fold/Unfold
alpha II; Lung tryptase; Mast cell alpha II tryptase; Mast cell beta I tryptase; Mast cell protease 7; Mast cell protease II; MCP 7; Pituitary tryptase; Skin tryptase; TPS 1; TPS1; TPS2; TPSAB1; TPSAB1 protein; TPSB1; Tryptase 1; Tryptase alpha 1; tryptase alpha I included; Tryptase alpha II; tryptase alpha II included; tryptase alpha included; tryptase alpha/beta 1; Tryptase beta 1; tryptase beta I included; Tryptase I; tryptase I included; Tryptase III; Tryptase skin;
Immunogens
A synthesized peptide derived from human TPSAB1, corresponding to a region within C-terminal amino acids.
Isoform 1 and isoform 2 are expressed in lung, stomach, spleen, heart and skin; in these tissues, isoform 1 is predominant. Isoform 2 is expressed in aorta, spleen, and breast tumor, with highest levels in the endothelial cells of some blood vessels surrounding the aorta, as well as those surrounding the tumor and low levels, if any, in mast cells (at protein level).
- Q15661 TRYB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Research Backgrounds
Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity. Isoform 2 cleaves large substrates, such as fibronectin, more efficiently than isoform 1, but seems less efficient toward small substrates.
Secreted.
Note: Released from the secretory granules upon mast cell activation.
Isoform 1 and isoform 2 are expressed in lung, stomach, spleen, heart and skin; in these tissues, isoform 1 is predominant. Isoform 2 is expressed in aorta, spleen, and breast tumor, with highest levels in the endothelial cells of some blood vessels surrounding the aorta, as well as those surrounding the tumor and low levels, if any, in mast cells (at protein level).
Belongs to the peptidase S1 family. Tryptase subfamily.
References
Application: IHC Species: Mouse Sample: Lung tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.