Product: TPSAB1 Antibody
Catalog: DF6758
Description: Rabbit polyclonal antibody to TPSAB1
Application: WB IHC IF/ICC
Cited expt.: IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 31kDa; 31kD(Calculated).
Uniprot: Q15661
RRID: AB_2838720

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
TPSAB1 Antibody detects endogenous levels of total TPSAB1.
RRID:
AB_2838720
Cite Format: Affinity Biosciences Cat# DF6758, RRID:AB_2838720.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

alpha II; Lung tryptase; Mast cell alpha II tryptase; Mast cell beta I tryptase; Mast cell protease 7; Mast cell protease II; MCP 7; Pituitary tryptase; Skin tryptase; TPS 1; TPS1; TPS2; TPSAB1; TPSAB1 protein; TPSB1; Tryptase 1; Tryptase alpha 1; tryptase alpha I included; Tryptase alpha II; tryptase alpha II included; tryptase alpha included; tryptase alpha/beta 1; Tryptase beta 1; tryptase beta I included; Tryptase I; tryptase I included; Tryptase III; Tryptase skin;

Immunogens

Immunogen:

A synthesized peptide derived from human TPSAB1, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
Q15661 TRYB1_HUMAN:

Isoform 1 and isoform 2 are expressed in lung, stomach, spleen, heart and skin; in these tissues, isoform 1 is predominant. Isoform 2 is expressed in aorta, spleen, and breast tumor, with highest levels in the endothelial cells of some blood vessels surrounding the aorta, as well as those surrounding the tumor and low levels, if any, in mast cells (at protein level).

Description:
Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, alpha and beta 1. Beta tryptases appear to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders.
Sequence:
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

Research Backgrounds

Function:

Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity. Isoform 2 cleaves large substrates, such as fibronectin, more efficiently than isoform 1, but seems less efficient toward small substrates.

Subcellular Location:

Secreted.
Note: Released from the secretory granules upon mast cell activation.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 1 and isoform 2 are expressed in lung, stomach, spleen, heart and skin; in these tissues, isoform 1 is predominant. Isoform 2 is expressed in aorta, spleen, and breast tumor, with highest levels in the endothelial cells of some blood vessels surrounding the aorta, as well as those surrounding the tumor and low levels, if any, in mast cells (at protein level).

Family&Domains:

Belongs to the peptidase S1 family. Tryptase subfamily.

References

1). Nano-silica particles synergistically IgE-mediated mast cell activation exacerbating allergic inflammation in mice. Frontiers in immunology, 2022 (PubMed: 35936002) [IF=5.7]

Application: IHC    Species: Mouse    Sample: Lung tissue

FIGURE 5 Representative images of lung histology and immunohistochemistry. (A) Lung tissue stained with hematoxylin and eosin (H&E) (× 200). (B) Lung tissue stained with periodic acid-Schiff stain (PAS) (× 200). (C) Immunohistochemistry analysis of mast cell tryptase in lung tissue. The arrow indicates anti-mast cell tryptase antibody-positive cells. Data are represented as the means ± SD. The unpaired t test was used to compare different groups.

2). MAF bZIP Transcription Factor B (MAFB) Protected Against Ovalbumin-Induced Allergic Rhinitis via the Alleviation of Inflammation by Restoring the T Helper (Th) 1/Th2/Th17 Imbalance and Epithelial Barrier Dysfunction. Journal of Asthma and Allergy, 2022 (PubMed: 35250280) [IF=3.7]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.