KLRD1 Antibody - #DF6773
| Product: | KLRD1 Antibody |
| Catalog: | DF6773 |
| Description: | Rabbit polyclonal antibody to KLRD1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 20kDa; 21kD(Calculated). |
| Uniprot: | Q13241 |
| RRID: | AB_2838735 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6773, RRID:AB_2838735.
Fold/Unfold
CD 94; CD94; CD94 antigen; Killer cell lectin like receptor subfamily D member 1; Killer cell lectin-like receptor subfamily D member 1; KLRD 1; KLRD1; KLRD1 protein; KLRD1_HUMAN; KP 43; KP43; Natural killer cells antigen CD94; NK cell receptor; OTTHUMP00000238754; OTTHUMP00000238755; OTTHUMP00000238756; OTTHUMP00000238758; OTTHUMP00000239093;
Immunogens
A synthesized peptide derived from human KLRD1, corresponding to a region within C-terminal amino acids.
- Q13241 KLRD1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Research Backgrounds
Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
Cell membrane>Single-pass type II membrane protein.
Natural killer cells.
Research Fields
· Human Diseases > Immune diseases > Graft-versus-host disease.
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.