CD83 Antibody - #DF6774
| Product: | CD83 Antibody |
| Catalog: | DF6774 |
| Description: | Rabbit polyclonal antibody to CD83 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 23kDa(Observed); 23kD(Calculated). |
| Uniprot: | Q01151 |
| RRID: | AB_2838736 |
Control Products
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6774, RRID:AB_2838736.
Fold/Unfold
B cell activation 45kDa cell surface glycoprotein Ig superfamily; B cell activation protein; B-cell activation protein; BL11; BL11 PEN; CD83; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); CD83 antigen; CD83 molecule; CD83_HUMAN; Cell surface glycoprotein; Cell surface protein HB15; HB15; hCD83;
Immunogens
A synthesized peptide derived from human CD83, corresponding to a region within the internal amino acids.
Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
- Q01151 CD83_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Research Backgrounds
May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
Membrane>Single-pass type I membrane protein.
Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.