Product: CD83 Antibody
Catalog: DF6774
Description: Rabbit polyclonal antibody to CD83
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 23kDa(Observed); 23kD(Calculated).
Uniprot: Q01151
RRID: AB_2838736

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CD83 Antibody detects endogenous levels of total CD83.
RRID:
AB_2838736
Cite Format: Affinity Biosciences Cat# DF6774, RRID:AB_2838736.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

B cell activation 45kDa cell surface glycoprotein Ig superfamily; B cell activation protein; B-cell activation protein; BL11; BL11 PEN; CD83; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); CD83 antigen; CD83 molecule; CD83_HUMAN; Cell surface glycoprotein; Cell surface protein HB15; HB15; hCD83;

Immunogens

Immunogen:

A synthesized peptide derived from human CD83, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q01151 CD83_HUMAN:

Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.

Description:
The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
Sequence:
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV

Research Backgrounds

Function:

May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Subcellular Location:

Membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.

References

1). Paricalcitol promotes the maturation of immune granulomas in an experimental model of superoxide dismutase A-induced inflammation. Inflammation research : official journal of the European Histamine Research Society ... [et al.], 2025 (PubMed: 40355595) [IF=4.8]

2). Иммуногистохимическая характеристика биопсийных образцов десны в области беззубого альвеолярного края челюсти. Пародонтология, 2024

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.