Product: p57 Kip2 Antibody
Catalog: DF6790
Description: Rabbit polyclonal antibody to p57 Kip2
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 32kDa; 32kD(Calculated).
Uniprot: P49918
RRID: AB_2838752

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
p57 Kip2 Antibody detects endogenous levels of total p57 Kip2.
RRID:
AB_2838752
Cite Format: Affinity Biosciences Cat# DF6790, RRID:AB_2838752.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Beckwith Wiedemann syndrome; BWCR; BWS; CDKI; CDKN 1C; CDKN1C; CDN1C_HUMAN; Cyclin dependent kinase inhibitor 1C; Cyclin dependent kinase inhibitor p57; Cyclin-dependent kinase inhibitor 1C; Cyclin-dependent kinase inhibitor p57; KIP 2; KIP2; p57; p57 Kip 2; p57KIP2; WBS;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P49918 CDN1C_HUMAN:

Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. Expressed in the eye. High levels are seen in the placenta while low levels are seen in the liver.

Description:
p27 Kip1 is a member of the Cip/Kip family of cyclin-dependent kinase inhibitors. Like its relatives, p57 Kip2 and p21 Waf1/Cip1, the ability to enforce the G1 restriction point is derived from its inhibitory binding to CDK2/cyclin E and other CDK/cyclin complexes. Expression levels of p27 are upregulated in quiescent cells and in cells treated with cAMP or other negative cell cycle regulators. Downregulation of p27 can be induced by treatment with interleukin-2 or other mitogens; this involves phosphorylation of p27 and its degradation by the ubiquitin-proteasome pathway (1-4).p57 Kip2 (Cyclin-dependent kinase inhibitor 1C) functions as a tumor suppressor. Mutations of p57 Kip2 have been associated with numerous human malignancies as well as Beckwith–Wiedemann syndrome (BWS), characterized by an increased risk of childhood cancer. The amino-terminal CDK inhibitory domain, common to the family, binds to and inhibits CDK/cyclin complexes and restricts cell cycle progression (5). The unique central region of p57 Kip2 interactes with LIMK-1, a downstream effector of the Rho family of GTPases. By sequestering LIMK-1 in the nucleus, p57 Kip2 disrupts actin dynamics within cells and may be linked to its essential role in embryonic development (6). In addition, the carboxyl-terminal QT domain of p57KIP2 binds to and inhibits JNK/SAPK activity regulating cellular apoptosis and differentiation (7). Expression levels of human p57 Kip2 are more restricted then other CDK inhibitors (8) and are controlled by ubiquitination/degradation via the Skp1/Cul1/F-box-type E3 ubiquitin ligase complex SCF-Skp2. This effect is dependent on Thr310 (9). A similar threonine phosphorylation site in p27 Kip1, Thr187, has also been shown to regulate protein stability (10).
Sequence:
MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR

PTMs - P49918 As Substrate

Site PTM Type Enzyme
S43 Phosphorylation
S146 Phosphorylation Q16539 (MAPK14)
K266 Acetylation
S268 Phosphorylation
K278 Acetylation
S282 Phosphorylation P31749 (AKT1)
S297 Phosphorylation
S299 Phosphorylation
S306 Phosphorylation
T310 Phosphorylation P31749 (AKT1)

Research Backgrounds

Function:

Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. Expressed in the eye. High levels are seen in the placenta while low levels are seen in the liver.

Subunit Structure:

Interacts with PCNA.

Family&Domains:

Belongs to the CDI family.

Research Fields

· Cellular Processes > Cell growth and death > Cell cycle.   (View pathway)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.