CDKN3 Antibody - #DF6791

Product: | CDKN3 Antibody |
Catalog: | DF6791 |
Description: | Rabbit polyclonal antibody to CDKN3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 24kDa; 24kD(Calculated). |
Uniprot: | Q16667 |
RRID: | AB_2838753 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6791, RRID:AB_2838753.
Fold/Unfold
CDI1; Cdk associated protein phosphatase; CDK2 associated dual specificity phosphatase; CDK2-associated dual-specificity phosphatase; CDKN3; CDKN3_HUMAN; CIP2; Cyclin dependent kinase inhibitor 3; Cyclin dependent kinase interacting protein 2; Cyclin dependent kinase interactor 1; Cyclin-dependent kinase inhibitor 3; Cyclin-dependent kinase interactor 1; Cyclin-dependent kinase-interacting protein 2; FLJ25787; KAP; KAP1; Kinase associated phosphatase; Kinase-associated phosphatase; MGC70625; OTTHUMP00000178991;
Immunogens
- Q16667 CDKN3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q16667 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S14 | Phosphorylation | Uniprot | |
S15 | Phosphorylation | Uniprot | |
K62 | Ubiquitination | Uniprot | |
K68 | Sumoylation | Uniprot | |
K86 | Ubiquitination | Uniprot | |
K135 | Ubiquitination | Uniprot | |
K184 | Ubiquitination | Uniprot | |
K195 | Ubiquitination | Uniprot |
Research Backgrounds
May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.
Cytoplasm>Perinuclear region.
Interacts with cyclin-dependent kinases such as CDK1, CDK2 and CDK3. Does not interact with CDK4. Interacts (via C-terminus) with phosphorylated CDK2 (via C-terminal helix). Interacts with MS4A3 (via C-terminus); the interaction enhances CDKN3 enzymatic activity.
Belongs to the protein-tyrosine phosphatase family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.