IL1RN Antibody - #DF6812
| Product: | IL1RN Antibody |
| Catalog: | DF6812 |
| Description: | Rabbit polyclonal antibody to IL1RN |
| Application: | WB IHC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 20kDa; 20kD(Calculated). |
| Uniprot: | P18510 |
| RRID: | AB_2838773 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6812, RRID:AB_2838773.
Fold/Unfold
DIRA; F630041P17Rik; ICIL 1RA; ICIL-1RA; ICIL1RA; IL-1ra; IL-1ra3; IL-1RN; IL1 inhibitor; IL1F3; IL1RA; IL1RA_HUMAN; IL1RN (IL1F3); IL1RN; Interleukin 1 receptor antagonist; Interleukin-1 receptor antagonist protein; Intracellular IL 1 receptor antagonist type II; Intracellular interleukin 1 receptor antagonist (icIL 1ra); IRAP; MGC10430; MVCD4; Type II interleukin 1 receptor antagonist;
Immunogens
A synthesized peptide derived from human IL1RN, corresponding to a region within the internal amino acids.
- P18510 IL1RA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.
Secreted.
Cytoplasm.
Cytoplasm.
Cytoplasm.
The intracellular form of IL1RN is predominantly expressed in epithelial cells.
References
Application: WB Species: Human Sample: MCF-7 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.