REG3A Antibody - #DF6825

Product: | REG3A Antibody |
Catalog: | DF6825 |
Description: | Rabbit polyclonal antibody to REG3A |
Application: | WB IHC |
Cited expt.: | WB |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 19kDa; 19kD(Calculated). |
Uniprot: | Q06141 |
RRID: | AB_2838785 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6825, RRID:AB_2838785.
Fold/Unfold
FLJ18565; Hepatocarcinoma intestine pancreas; Hepatointestinal pancreatic protein; HIP; HIP/PAP; Human proislet peptide; INGAP; Pancreatic beta cell growth factor; Pancreatitis associated protein 1; Pancreatitis associated protein; Pancreatitis-associated protein 1; PAP; PAP H; PAP homologous protein; PAP1; PBCGF; Proliferation inducing protein 34; Proliferation inducing protein 42; Reg III alpha; REG III; Reg III-alpha; REG-3-alpha; REG3; Reg3a; REG3A_HUMAN; Regenerating islet derived 3 alpha; Regenerating islet derived protein 3 alpha precursor; Regenerating islet-derived protein 3-alpha 15 kDa form; Regenerating islet-derived protein III-alpha;
Immunogens
A synthesized peptide derived from human REG3A, corresponding to a region within the internal amino acids.
Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level). Constitutively expressed in intestine. Low expression is found in healthy pancreas. Overexpressed during the acute phase of pancreatitis and in some patients with chronic pancreatitis.
- Q06141 REG3A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Research Backgrounds
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Proteolytic processing by trypsin removes an inhibitory N-terminal propeptide and is essential for peptidoglycan binding and antibacterial activity.
Secreted.
Note: Found in the apical region of pancreatic acinar cells.
Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level). Constitutively expressed in intestine. Low expression is found in healthy pancreas. Overexpressed during the acute phase of pancreatitis and in some patients with chronic pancreatitis.
The EPN motif is essential for recognition of the peptidoglycan carbohydrate backbone and for efficient bacterial killing with Glu-114 playing a key role in peptidoglycan binding and bactericidal activity.
References
Application: WB Species: Mice Sample: Intestinal Tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.