SPINLW1 Antibody - #DF6872
| Product: | SPINLW1 Antibody |
| Catalog: | DF6872 |
| Description: | Rabbit polyclonal antibody to SPINLW1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 15kDa; 15kD(Calculated). |
| Uniprot: | O95925 |
| RRID: | AB_2838831 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6872, RRID:AB_2838831.
Fold/Unfold
Cancer/testis antigen 71; CT 71; CT71; dJ461P17.2; Epididymal protease inhibitor; EPPIN 1; EPPIN 2; EPPIN 3; Eppin; EPPIN1; EPPIN2; EPPIN3; Protease inhibitor WAP7; Serine peptidase inhibitor like with Kunitz and WAP domains 1 (eppin); Serine peptidase inhibitor like with Kunitz and WAP domains 1; SPINLW 1; WAP 7; WAP four disulfide core domain 7; WAP four disulfide core domain protein 7; WAP7; WFDC 7; WFDC7;
Immunogens
A synthesized peptide derived from human SPINLW1, corresponding to a region within C-terminal amino acids.
In testis, expressed and secreted by Sertoli cells, appearing on the surface of testicular and ejaculate spermatozoa. Expressed in the spermatogonia and the earliest preleptotene spermatocytes. In the epididymis, is expressed and secreted by epithelial cells and covers the surface of epididymal spermatozoa and ciliated epithelial cells (at protein level). Expressed specifically in epididymis and testis. Isoform 2 is expressed only in the epididymis. Weak expression is detected in myoid cells as well as spermatogenic cells.
- O95925 EPPI_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP
Research Backgrounds
Serine protease inhibitor that plays an essential role in male reproduction and fertility. Modulates the hydrolysis of SEMG1 by KLK3/PSA (a serine protease), provides antimicrobial protection for spermatozoa in the ejaculate coagulum, and binds SEMG1 thereby inhibiting sperm motility.
Secreted. Cell surface.
Note: Bound to the surface of testicular and on the head and tail of ejaculate spermatozoa.
In testis, expressed and secreted by Sertoli cells, appearing on the surface of testicular and ejaculate spermatozoa. Expressed in the spermatogonia and the earliest preleptotene spermatocytes. In the epididymis, is expressed and secreted by epithelial cells and covers the surface of epididymal spermatozoa and ciliated epithelial cells (at protein level). Expressed specifically in epididymis and testis. Isoform 2 is expressed only in the epididymis. Weak expression is detected in myoid cells as well as spermatogenic cells.
The BPTI/Kunitz inhibitor domain is required for elastase inhibitory activity. BPTI/Kunitz inhibitor and WAP domains are involved in the protein antibacterial activity.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.