Product: P2RY6 Antibody
Catalog: DF6956
Description: Rabbit polyclonal antibody to P2RY6
Application: WB IHC IF/ICC
Cited expt.: IHC, IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Rabbit, Dog
Mol.Wt.: 36kDa(Observed); 36kD(Calculated).
Uniprot: Q15077
RRID: AB_2838912

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IHC 1:50-1:100, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Pig(100%), Bovine(100%), Sheep(100%), Rabbit(100%), Dog(100%)
Clonality:
Polyclonal
Specificity:
P2RY6 Antibody detects endogenous levels of total P2RY6.
RRID:
AB_2838912
Cite Format: Affinity Biosciences Cat# DF6956, RRID:AB_2838912.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

G coupled nucleotide receptor; G protein coupled 6; MGC15335; P2 purinoceptor; P2ry6; P2RY6_HUMAN; P2Y purinoceptor 6; P2Y6; P2Y6 receptor; PP2891; Purinergic receptor P2Y6; pyrimidinergic receptor P2Y; Pyrimidinergic receptor P2Y, G protein coupled, 6;

Immunogens

Immunogen:

A synthesized peptide derived from human P2RY6, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
The product of this gene belongs to the family of P2 receptors, which is activated by extracellular nucleotides and subdivided into P2X ligand-gated ion channels and P2Y G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor, which is a G-protein coupled receptor, is responsive to UDP, partially responsive to UTP and ADP, and not responsive to ATP. It is proposed that this receptor mediates inflammatory responses. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Mar 2013]
Sequence:
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Horse
0
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Receptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

References

1). Macrophage P2Y6R activation aggravates psoriatic inflammation through IL-27-mediated Th1 responses. Acta pharmaceutica Sinica. B, 2024 (PubMed: 39525587) [IF=14.7]

Application: IF/ICC    Species: human    Sample:

Figure 1. Macrophage P2Y6R expression is increased in psoriatic lesional skin and involved in Th1 cells mediated psoriasis processes. (A) Expression of purinergic receptors in human and mice psoriasis skin. (B) Linear regression analysis indicated a positive correlation between P2ry6 mRNA expression and PASI score in GSE117468. (C) Flow diagram. (D) Skin thickness was measured from Day 0 to Day 6 (n = 12). (E) Represent images for the psoriatic appearance on IMQ or Vaseline-treated WT mice and P2Y6R−/− mice skin. (F) The representative image of spleen from the mice. (G) The spleen index on Day 6 (n = 12). (H) H&E staining of IMQ-treated WT mice and P2Y6R−/− mice skin (n = 3). (I) Ki67 staining of skin tissues from WT or P2Y6R−/− mice treated with Vaseline or IMQ (n = 3). (J) Immune infiltration correlation coefficient of lymphoid cells and myeloid cells of P2ry6 in GSE181318 and GSE14905. (K) scRNA-seq data of GSE151177 were grouped into 8 clusters with UMAP. (L) Expression of P2Y6R in different cells form scRNA-seq data. (M) Represent immunofluorescence images of Macrophages CD86 (red) and P2Y6R (green) co-localization in mice skin treated with Vaseline or IMQ (n = 3). Scale bar = 50 μm. (N) CellChat analysis indicated the inferred interaction among macrophages in psoriasis patient. (O–P) Th1 cells (CD4+ IFNγ+) proportion was decreased in IMQ-induced P2Y6R−/− mice skin and spleen (n = 3). Data are expressed as mean ± SEM. ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001.

Application: IHC    Species: Mouse    Sample:

Figure 4. IMQ-induced psoriasis mice is reduced in Lyz2creP2Y6Rfl/fl mice. (A) Experimental scheme. (B) Representative skin pictures of Lyz2creP2Y6Rfl/fl and P2Y6Rfl/fl mice. (C) Pictures of spleen and (D) spleen index from all groups (n = 12). (E, F) H&E staining (n = 3) and skin thickness, erythema, and scaling PASI score (n = 12) of IMQ or Vaseline-treated Lyz2cre P2Y6Rfl/fl and P2Y6Rfl/fl mice skin. (G) Ki67 staining of IMQ-treated skin tissues from P2Y6Rfl/fl or Lyz2creP2Y6Rfl/fl mice treated with Saline or IL-27 (n = 3). (H) Serum and skin concentrations of IL-27 and IFNγ detected by ELISA assay (n = 4). (I, J) Flow analysis of Th1 cells from skin and spleens of Lyz2creP2Y6Rfl/fl and P2Y6Rfl/fl mice treated with IMQ or Vaseline (n = 3). (K–M) Quantitative analysis of protein expression in mice skin. Normal protein levels were normalized to β-actin, and the values for the phosphorylated forms of proteins were normalized to phosphorylation-independent levels of the same protein. (n = 4). (N) The mRNA expression levels of Th1-related cytokine and IL-27 p28 and Ebi3 in skin tissues (n = 3). All mRNA levels were normalized to GAPDH mRNA. Data are expressed as mean ± SEM. ∗P < 0.05, ∗∗P < 0.01, ∗∗∗P < 0.001.

2). Inhibition of P2Y6 receptor expression in Kupffer cells alleviates alcoholic steatohepatitis in mice. International Immunopharmacology, 2022 (PubMed: 35700583) [IF=4.8]

3). P2Y6R Inhibition Induces Microglial M2 Polarization by Promoting PINK1/Parkin-Dependent Mitophagy After Spinal Cord Injury. Molecular neurobiology, 2024 (PubMed: 39607640) [IF=4.6]

4). Pyrimidinergic receptor P2Y6 expression is elevated in lung adenocarcinoma and is associated with poor prognosis. Cancer Biomarkers, 2023 (PubMed: 37545227) [IF=2.2]

5). Activation of hepatic embryonic stem cell factors are essential biopredictive markers for hepatocellular carcinoma. Research Square, 2023

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.