Product: Claudin 10 Antibody
Catalog: AF0133
Description: Rabbit polyclonal antibody to Claudin 10
Application: WB IHC IF/ICC
Cited expt.: WB, IHC
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 25kDa(Observed); 24kD(Calculated).
Uniprot: P78369
RRID: AB_2833317

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Prediction:
Pig(100%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%), Chicken(%)
Clonality:
Polyclonal
Specificity:
Claudin 10 Antibody detects endogenous levels of total Claudin 10.
RRID:
AB_2833317
Cite Format: Affinity Biosciences Cat# AF0133, RRID:AB_2833317.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Claudin-10; Claudin10; CLD10_HUMAN; CLDN 10; CLDN10; CLDN10 protein; CPETRL 3; CPETRL3; HGNC:2033; OSP L; OSP like protein; OSP-like protein; OSPL;

Immunogens

Immunogen:

A synthesized peptide derived from human Claudin 10, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P78369 CLD10_HUMAN:

Expressed in the kidney, eccrine sweat glands and in all layers of the epidermis. In the kidney, it is detected in the thick ascending limb of Henle's loop (TAL) (PubMed:28771254, PubMed:28686597). In the sweat glands, it is expressed in cells from secretory portions, corresponding to the clear cells (PubMed:28686597).

Description:
claudin 10 Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. Belongs to the claudin family.
Sequence:
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Dog
100
Rabbit
100
Chicken
86
Xenopus
0
Zebrafish
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Involved in the regulation of paracellular epithelia permeability to ions in multiple organs. It acts as a paracellular ion channel probably forming permselective pores; isoform 1 appears to create pores preferentially permeable to cations and isoform 2 for anions. In sweat glands and in the thick ascending limb (TAL) of Henle's loop in kidney, it controls paracellular sodium permeability which is essential for proper sweat production and renal function.

Subcellular Location:

Cell junction>Tight junction. Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in the kidney, eccrine sweat glands and in all layers of the epidermis. In the kidney, it is detected in the thick ascending limb of Henle's loop (TAL). In the sweat glands, it is expressed in cells from secretory portions, corresponding to the clear cells.

Family&Domains:

The fourth transmembrane region (161-181) is necessary for integration into tight junctions.

Belongs to the claudin family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Tight junction.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Human Diseases > Infectious diseases: Viral > Hepatitis C.

· Organismal Systems > Immune system > Leukocyte transendothelial migration.   (View pathway)

References

1). Extrajunctional CLDN10 cooperates with LAT1 and accelerates clear cell renal cell carcinoma progression. Cell communication and signaling : CCS, 2024 (PubMed: 39639312) [IF=8.4]

2). Claudin-10 overexpression suppresses human clear cell renal cell carcinoma growth and metastasis by regulating ATP5O and causing mitochondrial dysfunction. International Journal of Biological Sciences, 2022 (PubMed: 35414767) [IF=8.2]

Application: IHC    Species: mouse    Sample: renal

Figure 1. |CLDN10 is low expressed in ccRCC and decreased CLDN10 expression is associated with ccRCC metastasis and poor prognosis. A, CLDN10 expression was analyzed by immunohistochemistry in 54 pairs of paraffin sections of ccRCC and adjacent normal renal tissues (AN).

3). Epigenetic silencing and CRISPR-mediated reactivation of tight junction protein claudin10b (CLDN10B) in renal cancer. Clinical epigenetics, 2025 (PubMed: 40524239) [IF=5.7]

4). CLDN10 associated with immune infiltration is a novel prognostic biomarker for clear cell renal cell carcinoma. Epigenomics, 2021 (PubMed: 33203244) [IF=3.0]

Application: WB    Species: Human    Sample: renal tubular epithelial cell

Figure 2. Expression profile of CLDN10 in mccRCC tissues and cell line, and its relationship with overall survival (OS) and disease-free survival (DFS). (A–C) Plots showing the expression profile of CLDN10 in mccRCC tissues and AN based on the data from TCGA-KIRC, GSE66271 and GSE105288, respectively. (D) Plot showing the expression profile of CLDN10 in mccRCC cell line Caki-1 and healthy kidney epithelial cell line (ASE-5063) based on the data from GSE78179. (E) Kaplan-Meier curves of OS and DFS in 80 and 53 mccRCC patients, respectively. Patients were separated into two groups according to the median cutoff of CLDN10 expression. (F) Heatmap of CLDN10 mRNA expression in 54 paired ccRCC tissues. (G) Statistical comparison of CLDN10 mRNA expression between ccRCC tissues and AN. (H) Statistical comparison of CLDN10 mRNA expression between mccRCC tissues (M1) and ccRCC tissues (M0). (I) The expression of CLDN10 protein in HK2, 786-O, A498 and Caki-1 cell lines. AN: Adjacent normal tissues; DFS: Disease-free survival; mccRCC: Metastatic clear cell renal cell carcinoma; OS: Overall survival.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.