Product: Granzyme B Antibody
Catalog: DF7012
Description: Rabbit polyclonal antibody to Granzyme B
Application: WB IHC
Cited expt.: IHC
Reactivity: Human
Mol.Wt.: 27kDa; 28kD(Calculated).
Uniprot: P10144
RRID: AB_2838968

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
Granzyme B Antibody detects endogenous levels of total Granzyme B.
RRID:
AB_2838968
Cite Format: Affinity Biosciences Cat# DF7012, RRID:AB_2838968.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

C11; Cathepsin G like 1; Cathepsin G-like 1; CCPI; CGL 1; CGL1; CSP B; CSPB; CTLA-1; CTLA1; CTSGL1; Cytotoxic serine protease B; Cytotoxic T lymphocyte associated serine esterase 1; Cytotoxic T lymphocyte proteinase 2; Cytotoxic T-lymphocyte proteinase 2; Fragmentin 2; Fragmentin-2; GRAB_HUMAN; Granzyme 2; Granzyme B (granzyme 2, cytotoxic T lymphocyte associated serine esterase 1); Granzyme B; Granzyme-2; GranzymeB; GRB; Gzmb; Hlp; Human lymphocyte protein; Lymphocyte protease; Protease, serine, B; SECT; T cell serine protease 1-3E; T-cell serine protease 1-3E;

Immunogens

Immunogen:

A synthesized peptide derived from human Granzyme B, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Description:
Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein encoded by this gene is crucial for the rapid induction of target cell apoptosis by CTL in cell-mediated immune response.
Sequence:
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Research Backgrounds

Function:

This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis.

Subcellular Location:

Cytoplasmic granule.
Note: Cytoplasmic granules of cytolytic T-lymphocytes and natural killer cells.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the peptidase S1 family. Granzyme subfamily.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.

· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.

· Human Diseases > Immune diseases > Autoimmune thyroid disease.

· Human Diseases > Immune diseases > Allograft rejection.

· Human Diseases > Immune diseases > Graft-versus-host disease.

· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.   (View pathway)

References

1). pH-Triggered Copper-Free Click Reaction-Mediated Micelle Aggregation for Enhanced Tumor Retention and Elevated Immuno–Chemotherapy against Melanoma. ACS Applied Materials & Interfaces, 2021 (PubMed: 33834754) [IF=8.3]

Application: IHC    Species: mice    Sample: NK cells

Figure 6. (A) Immunofluorescent CLSM images of B16F10 tumor slices at the end of treatment, NK cells were identified by the antimouse NKp46 antibody (red), and nuclei were visualized by DAPI (blue). Scale bar: 100 μm. (B) Flow cytometric analysis of intratumor NK cell populations identified by PE-conjugated antimouse NKp46. Error bars indicate SD (n = 3). ** and *** represent p < 0.01 and p < 0.001, respectively. (C) Typical immunohistochemical images of the B16F10 tumor sections stained with antibodies against IL-2 and GZMB. Scale bar: 100 μm. (D) Levels of IL-2, GZMB, and IFN-γ in tumor and (E) plasma analyzed by ELISA kits at the end of treatment. Error bars indicate SD (n = 3), *, **, and *** represent p < 0.05, p < 0.01, and p < 0.001, respectively. (F) Images of the expression level of intratumor phosphorylated Smad3 (pSmad3) and Smad3 by western blotting analysis, (a) PBS, (b) M-D@DOX, (c) free DOX/SIS3, (d) M-N@SIS3, (e) M@DOX/SIS3, and (f) MDN@DOX/SIS3. (G) Semiquantitative results of the expression levels of p-Smad3 and Smad3. Error bars indicate SD (n = 3), ** and *** represent p < 0.01 and p < 0.001, respectively.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.