FBXO32 Antibody - #DF7075

Product: | FBXO32 Antibody |
Catalog: | DF7075 |
Description: | Rabbit polyclonal antibody to FBXO32 |
Application: | WB IHC |
Cited expt.: | WB, IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 40kDa; 42kD(Calculated). |
Uniprot: | Q969P5 |
RRID: | AB_2839031 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7075, RRID:AB_2839031.
Fold/Unfold
4833442G10Rik; AI430017; Atrogin 1; Atrogin-1; ATROGIN1; Atrophy gene 1; F box only protein 32; F-box only protein 32; F-box protein 32; FBX32_HUMAN; fbxo25; FBXO32; FLJ32424; MAFbx; MGC108443; MGC137646; MGC33610; Muscle atrophy F box; Muscle atrophy F box protein; Muscle atrophy F-box protein;
Immunogens
A synthesized peptide derived from human FBXO32, corresponding to a region within N-terminal amino acids.
- Q969P5 FBX32_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.
Cytoplasm. Nucleus.
Note: Shuttles between cytoplasm and the nucleus.
Specifically expressed in cardiac and skeletal muscle.
Research Fields
· Environmental Information Processing > Signal transduction > FoxO signaling pathway. (View pathway)
References
Application: WB Species: Mouse Sample: C2C12 cell
Application: IF/ICC Species: Human Sample:
Application: WB Species: Human Sample:
Application: IHC Species: rat Sample: muscles
Application: WB Species: rat Sample: muscles
Application: IHC Species: mouse Sample: basal and apical IHCs
Application: WB Species: rat Sample: gastrocnemius
Application: WB Species: mouse Sample:
Application: WB Species: Mouse Sample: GA tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.