Product: CX3CR1 Antibody
Catalog: DF7096
Description: Rabbit polyclonal antibody to CX3CR1
Application: WB IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 44kDa(Observed); 40kD(Calculated).
Uniprot: P49238
RRID: AB_2839051

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse, Rat
Clonality:
Polyclonal
Specificity:
CX3CR1 Antibody detects endogenous levels of total CX3CR1.
RRID:
AB_2839051
Cite Format: Affinity Biosciences Cat# DF7096, RRID:AB_2839051.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Beta chemokine receptor-like 1; C X3 C CKR 1; C-X3-C CKR-1; CCRL1; Chemokine C X3 C motif receptor 1; CMK BRL 1; CMK-BRL-1; CMK-BRL1; CMKBLR1; CMKDR1; CX3C chemokine receptor 1; CX3C CKR1; CX3C1_HUMAN; CX3CR1; Fractalkine receptor; G-protein coupled receptor 13; GPR13; GPRV28; V28;

Immunogens

Immunogen:

A synthesized peptide derived from human CX3CR1, corresponding to a region within N-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
P49238 CX3C1_HUMAN:

Expressed in lymphoid and neural tissues.

Description:
Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene.
Sequence:
MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL

Research Backgrounds

Function:

Receptor for the CX3C chemokine fractalkine (CX3CL1); binds to CX3CL1 and mediates both its adhesive and migratory functions. Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro). Isoform 2 and isoform 3 seem to be more potent HIV-1 coreceptors than isoform 1.

PTMs:

This protein is not N-glycosylated which is unusual for G-protein-coupled receptors.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in lymphoid and neural tissues.

Family&Domains:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.   (View pathway)

· Organismal Systems > Immune system > Chemokine signaling pathway.   (View pathway)

References

1). LGR6 modulates intervertebral disc degeneration through regulation of macrophage efferocytosis. Journal of translational medicine, 2025 (PubMed: 40281518) [IF=7.4]

Application: WB    Species: human    Sample: NPCs

Fig. 8 Effects of LGR6 on efferocytosis in the context of inflammation-induced NPCs apoptosis. (A-E) Relative mRNA expression levels of LGR6, MERTK, AXL, TYRO3, and CX3CR1 in macrophages (n = 3; one-way ANOVA). (F-K) Western blot and quantification of protein expression levels for MERTK, AXL, TYRO3, and CX3CR1. (L) The representative images of efferocytosis in macrophages co-cultured with NPCs in OE-NC or OE-LGR6 models over time (1 h, 12 h, 18 h, 24 h) (n = 3; one-way ANOVA). (M) Quantification of efferocytosis at different time points. (N-S) Western blot and protein quantification of LGR6, MERTK, AXL, TYRO3, and CX3CR1 (n = 3; one-way ANOVA). (T) The representative images of efferocytosis in macrophages co-cultured with NPCs in sh-NC or sh-LGR6 models over time (1 h, 12 h, 18 h, 24 h) (n = 3; one-way ANOVA). (U) Quantification of efferocytosis at different time points (n = 3; one-way ANOVA). Data are presented as mean ± SD.

2). Induction of CX3CL1 expression by LPS and its impact on invasion and migration in oral squamous cell carcinoma. Frontiers in cell and developmental biology, 2024 (PubMed: 38915444) [IF=4.6]

Application: WB    Species: human    Sample: OSCC cell

Figure 2. mRNA and protein expression of CX3CL1 and CX3CR1 in OSCC cell lines. Notes: (A) and (B) show the mRNA expression levels of CX3CL1 and CX3CR1 in HOK and various OSCC cell lines using PCR; (C) and (D) show the protein expression levels of membrane-bound CX3CL1 and CX3CR1 in HOK and various OSCC cell lines using WB, along with their corresponding gray value analysis; (E) shows the OD value analysis of soluble CX3CL1 protein expression in HOK and various OSCC cell lines using ELISA. The results indicate that CX3CL1 mRNA and protein expression levels are significantly decreased in most OSCC cell lines compared to HOK, while soluble CX3CL1 that has the function of chemoattracting cells expressing CX3CR1. Expression is increased and CX3CR1 protein content is significantly decrease. Data were shown as mean with SD (n ≥ 3). *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001, ns p > 0.05. The inconsistent results between PCR and WB may be due to differences in transcription and translation control. The low expression levels of CX3CL1 and CX3CR1 genes in OSCC, as validated by mRNA and protein content analysis in OSCC tissues and cell lines, suggest that they may play a suppressive role in the development and progression of OSCC.

3). Electroacupuncture Preconditioning Ameliorates the Ischemic Microenvironment to Improve Long-Term Potentiation in Chronic Cerebral Hypoperfusion Rats With MGE Neural Progenitor Transplantation. Neural plasticity, 2025 (PubMed: 40969839) [IF=3.0]

Application: WB    Species: Rat    Sample: hippocampus

Figure 3 (A) Detect the expressions of microglia marker Iba1, chemokine CX3CL1, CX3CR1 in the hippocampus of each group by western blot. (A) Representative western blot bands. (B–D) Statistical analysis of microglia marker Iba1, chemokine CX3CL1, and its receptor CX3CR1.  ∗∗∗p < 0.001,  ∗∗p < 0.01,  ∗p < 0.05, one-way ANOVA. All data were expressed as mean ± standard error of the mean (SEM; n = 5 rats/per group).

4). Targeting hepatocyte MagL regulates the progression of colorectal liver metastases during liver ischemia-reperfusion. Research Square, 2022

Application: IF/ICC    Species: Mouse    Sample:

Figure 4. Hepatocyte MagL promotes inflammation resolution after LIR by affecting macrophage M2 polarization The mice in the siMagL group and the siCtrl group were subjected to partial warm ischemia for 90 minutes, and the ischemic lobes of the mice were harvested after 3 days of reperfusion. A NPCs were sorted, and the expressions of Ly6C, CD11b, CX3CR1 and their corresponding quantification were analyzed by flow cytometry. B Representative immunofluorescence images of CD206 (red) and Mertk (green) in ischemic lobes of the liver, Scale bar, 100mm. C Representative immunofluorescence images of Arg1 (red), CX3CR1 (green) and TGF-β (pink) in the ischemic lobe of the liver, Scale bar, 100mm. D Detection of M2 polarization-related markers and cytokine gene expression in liver ischemic lobes by qPCR. E The protein levels of M2 polarization-related markers in ischemic lobes of liver were detected by Western Blot. Data are presented as mean ± SD. ( *, P < 0.05; * *, P < 0.01). The data represent three separate experiments.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.