LAMP3 Antibody - #DF7099
Product: | LAMP3 Antibody |
Catalog: | DF7099 |
Description: | Rabbit polyclonal antibody to LAMP3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 44kDa; 44kD(Calculated). |
Uniprot: | Q9UQV4 |
RRID: | AB_2839054 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7099, RRID:AB_2839054.
Fold/Unfold
CD208; CD208 antigen; DC LAMP; DC lysosome associated membrane glycoprotein; DC-lysosome-associated membrane glycoprotein; DCLAMP; LAMP; LAMP 3; LAMP-3; Lamp3; LAMP3_HUMAN; Lysosomal associated membrane protein 3; Lysosomal-associated membrane protein 3; Lysosome-associated membrane glycoprotein 3; Protein TSC403; TSC403;
Immunogens
A synthesized peptide derived from human LAMP3, corresponding to a region within the internal amino acids.
Detected in tonsil interdigitating dendritic cells, in spleen, lymph node, Peyer's patches in the small instestine, in thymus medulla and in B-cells (at protein level). Expressed in lymphoid organs and dendritic cells. Expressed in lung. Up-regulated in carcinomas of the esophagus, colon, rectum, ureter, stomach, breast, fallopian tube, thyroid and parotid tissues.
- Q9UQV4 LAMP3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI
Research Backgrounds
May play a role in dendritic cell function and in adaptive immunity.
Lysosome membrane>Single-pass type I membrane protein. Cytoplasmic vesicle membrane>Single-pass type I membrane protein.
Note: During dendritic cell maturation, detected on cytoplasmic vesicles (the MHC II compartment) that contain MHC II proteins, LAMP1, LAMP2 and LAMP3 (PubMed:9768752). Detected on lysosomes in mature dendritic cells (PubMed:9768752).
Detected in tonsil interdigitating dendritic cells, in spleen, lymph node, Peyer's patches in the small instestine, in thymus medulla and in B-cells (at protein level). Expressed in lymphoid organs and dendritic cells. Expressed in lung. Up-regulated in carcinomas of the esophagus, colon, rectum, ureter, stomach, breast, fallopian tube, thyroid and parotid tissues.
Belongs to the LAMP family.
Research Fields
· Cellular Processes > Transport and catabolism > Lysosome. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.