IGFBP1 Antibody - #DF7130
| Product: | IGFBP1 Antibody |
| Catalog: | DF7130 |
| Description: | Rabbit polyclonal antibody to IGFBP1 |
| Application: | WB IHC |
| Cited expt.: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Horse, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 28kDa; 28kD(Calculated). |
| Uniprot: | P08833 |
| RRID: | AB_2839084 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7130, RRID:AB_2839084.
Fold/Unfold
AFBP; Alpha pregnancy associated endometrial globulin; Amniotic fluid binding protein; Binding protein 25; Binding protein 26; Binding protein 28; Growth hormone independent binding protein; hIGFBP 1; hIGFBP1; IBP 1; IBP-1; IBP1; IBP1_HUMAN; IGF binding protein 1; IGF BP25; IGF-binding protein 1; IGFBP 1; IGFBP-1; IGFBP1; Insulin like growth factor binding protein 1; Insulin-like growth factor-binding protein 1; Placental protein 12; PP 12; PP12;
Immunogens
A synthesized peptide derived from human IGFBP1, corresponding to a region within C-terminal amino acids.
- P08833 IBP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.
Phosphorylated; probably by casein kinase II. Phosphorylation alters the affinity of the protein for IGFs. In amniotic fluid, the unmodified protein is the most abundant form, while mono-, bi-, tri- and tetraphosphorylated forms are present in decreasing amounts. The phosphorylation state may influence the propensity to proteolysis.
Secreted.
References
Application: WB Species: Rat Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.