Product: LHB Antibody
Catalog: DF7140
Description: Rabbit polyclonal antibody to LHB
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 15kD; 15kD(Calculated).
Uniprot: P01229
RRID: AB_2839094

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
LHB Antibody detects endogenous levels of total LHB.
RRID:
AB_2839094
Cite Format: Affinity Biosciences Cat# DF7140, RRID:AB_2839094.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CGB4; CHORIONIC GONADOTROPIN, BETA POLYPEPTIDE 4; hLHB; Interstitial cell stimulating hormone beta chain; Leutropin; LH-B; LHB; LSH beta; LSH-B; LSH-beta; LSHB; LSHB_HUMAN; Luteinizing hormone beta polypeptide; Luteinizing hormone subunit beta; Lutropin beta chain; Lutropin subunit beta;

Immunogens

Immunogen:

A synthesized peptide derived from human LHB, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
P01229 LSHB_HUMAN:

Pituitary gland.

Description:
This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism.
Sequence:
MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL

Research Backgrounds

Function:

Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Pituitary gland.

Family&Domains:

Belongs to the glycoprotein hormones subunit beta family.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.

· Organismal Systems > Endocrine system > Ovarian steroidogenesis.

· Organismal Systems > Endocrine system > Prolactin signaling pathway.   (View pathway)

References

1). The Novel Competing Endogenous Long Noncoding RNA SM2 Regulates Gonadotropin Secretion in the Hu Sheep Anterior Pituitary by Targeting the Oar-miR-16b/TGF-β/SMAD2 Signaling Pathway. Cells, 2022 (PubMed: 35326436) [IF=6.0]

2). Single-Cell Transcriptional Profile Construction of Rat Pituitary Glands before and after Sexual Maturation and Identification of Novel Marker Spp1 in Gonadotropes. International journal of molecular sciences, 2024 (PubMed: 38731915) [IF=5.6]

3). PPP2R2A promotes Hu sheep pituitary cell proliferation and gonadotropin secretion associated with prolificacy. Animal reproduction science, 2024 (PubMed: 38677100) [IF=2.2]

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.