14-3-3 gamma Antibody - #DF7156
Product: | 14-3-3 gamma Antibody |
Catalog: | DF7156 |
Description: | Rabbit polyclonal antibody to 14-3-3 gamma |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 28kDa; 28kD(Calculated). |
Uniprot: | P61981 |
RRID: | AB_2839108 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7156, RRID:AB_2839108.
Fold/Unfold
14 3 3 gamma; 14 3 3 protein gamma; 14 3 3 protein gamma subtype; 14 3 3gamma; 14-3-3 protein gamma; 1433G_HUMAN; 3 monooxygenase/tryptophan 5 monooxgenase activation protein gamma polypeptide; KCIP 1; KCIP-1; KCIP1; N-terminally processed; Protein kinase C inhibitor protein 1; Tyrosine 3 monooxygenase/tryptophan 5 monooxygenase activation protein gamma polypeptide; Ywhag;
Immunogens
- P61981 1433G_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P61981 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
V2 | Acetylation | Uniprot | |
K10 | Ubiquitination | Uniprot | |
Y20 | Phosphorylation | Uniprot | |
K28 | Ubiquitination | Uniprot | |
T31 | Phosphorylation | Uniprot | |
S38 | Phosphorylation | Uniprot | |
S46 | Phosphorylation | Uniprot | |
Y49 | Phosphorylation | Uniprot | |
K50 | Acetylation | Uniprot | |
K50 | Methylation | Uniprot | |
K50 | Ubiquitination | Uniprot | |
S59 | Phosphorylation | Q9NRM7 (LATS2) | Uniprot |
S65 | Phosphorylation | Uniprot | |
K69 | Acetylation | Uniprot | |
K69 | Ubiquitination | Uniprot | |
S71 | Phosphorylation | Uniprot | |
K77 | Ubiquitination | Uniprot | |
K110 | Ubiquitination | Uniprot | |
T115 | Phosphorylation | Uniprot | |
Y117 | Phosphorylation | Uniprot | |
S119 | Phosphorylation | Uniprot | |
K120 | Acetylation | Uniprot | |
K120 | Ubiquitination | Uniprot | |
K125 | Acetylation | Uniprot | |
K125 | Ubiquitination | Uniprot | |
K127 | Ubiquitination | Uniprot | |
Y130 | Phosphorylation | Uniprot | |
Y131 | Phosphorylation | Uniprot | |
Y133 | Phosphorylation | Uniprot | |
T139 | Phosphorylation | Uniprot | |
K142 | Acetylation | Uniprot | |
K142 | Ubiquitination | Uniprot | |
K152 | Acetylation | Uniprot | |
K152 | Ubiquitination | Uniprot | |
S155 | Phosphorylation | Uniprot | |
K162 | Acetylation | Uniprot | |
K162 | Ubiquitination | Uniprot | |
T168 | Phosphorylation | Uniprot | |
Y179 | Phosphorylation | Uniprot | |
S180 | Phosphorylation | Uniprot | |
K198 | Ubiquitination | Uniprot | |
T199 | Phosphorylation | Uniprot | |
T210 | Phosphorylation | Uniprot | |
S215 | Phosphorylation | Uniprot | |
Y216 | Phosphorylation | Uniprot | |
S219 | Phosphorylation | Uniprot | |
T220 | Phosphorylation | Uniprot | |
T234 | Phosphorylation | Uniprot | |
S235 | Phosphorylation | Uniprot |
Research Backgrounds
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
Phosphorylated by various PKC isozymes.
Cytoplasm.
Highly expressed in brain, skeletal muscle, and heart.
Homodimer. Interacts with SAMSN1 (By similarity). Interacts with RAF1, SSH1 and CRTC2/TORC2. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Interacts with GAB2. Interacts with MDM4 (phosphorylated); negatively regulates MDM4 activity toward TP53. Interacts with PKA-phosphorylated AANAT and SIRT2.Interacts with the 'Thr-369' phosphorylated form of DAPK2. Interacts with PI4KB, TBC1D22A and TBC1D22B. Interacts with SLITRK1. Interacts with LRRK2; this interaction is dependent on LRRK2 phosphorylation. Interacts with MARK2 and MARK3.
Belongs to the 14-3-3 family.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Cellular Processes > Cell growth and death > Oocyte meiosis. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Hippo signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.