TTF1 Antibody - #DF7184
Product: | TTF1 Antibody |
Catalog: | DF7184 |
Description: | Rabbit polyclonal antibody to TTF1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Chicken, Xenopus |
Mol.Wt.: | 42kDa; 39kD(Calculated). |
Uniprot: | P43699 |
RRID: | AB_2839136 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7184, RRID:AB_2839136.
Fold/Unfold
AV026640; BCH; Benign chorea; BHC; Homeobox protein NK 2 homolog A; Homeobox protein NK-2 homolog A; Homeobox protein Nkx 2.1; Homeobox protein Nkx-2.1; Homeobox protein Nkx2.1; NK 2; NK 2 homolog A; NK2; NK2 homeobox 1; NK2, drosophila, homolog of, A; NK2.1, mouse, homolog of; Nkx 2 1; NKX 2.1; NKX 2A; NKX2 1; Nkx2-1; NKX2.1; NKX21_HUMAN; NKX2A; T EBP; T/EBP; TEBP; Thyroid nuclear factor 1; Thyroid nuclear factor; Thyroid specific enhancer binding protein; Thyroid transcription factor 1; Tin man; Tinman; TITF 1; TITF1; TTF 1; TTF-1; TTF1;
Immunogens
- P43699 NKX21_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P43699 As Substrate
Research Backgrounds
Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Forms a regulatory loop with GRHL2 that coordinates lung epithelial cell morphogenesis and differentiation. Activates the transcription of GNRHR and plays a role in enhancing the circadian oscillation of its gene expression. Represses the transcription of the circadian transcriptional repressor NR1D1 (By similarity).
Phosphorylated on serine residues by STK3/MST2.
Nucleus.
Thyroid and lung.
Interacts with WWTR1.
Belongs to the NK-2 homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.