GMNN Antibody - #DF7270
Product: | GMNN Antibody |
Catalog: | DF7270 |
Description: | Rabbit polyclonal antibody to GMNN |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Rabbit |
Mol.Wt.: | 23kDa; 24kD(Calculated). |
Uniprot: | O75496 |
RRID: | AB_2839209 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7270, RRID:AB_2839209.
Fold/Unfold
DNA replication inhibitor; Gem; GEMI_HUMAN; Geminin; Geminin DNA replication inhibitor; GMNN; OTTHUMP00000039393; RP3 369A17.3;
Immunogens
- O75496 GEMI_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O75496 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K17 | Ubiquitination | Uniprot | |
T25 | Phosphorylation | O14965 (AURKA) | Uniprot |
K27 | Acetylation | Uniprot | |
K27 | Ubiquitination | Uniprot | |
S32 | Phosphorylation | Uniprot | |
S34 | Phosphorylation | Uniprot | |
S36 | Phosphorylation | Uniprot | |
S45 | Phosphorylation | Uniprot | |
S49 | Phosphorylation | Uniprot | |
K50 | Acetylation | Uniprot | |
K50 | Ubiquitination | Uniprot | |
K52 | Ubiquitination | Uniprot | |
T59 | Phosphorylation | Uniprot | |
S60 | Phosphorylation | Uniprot | |
T61 | Phosphorylation | Uniprot | |
S63 | Phosphorylation | Uniprot | |
S64 | Phosphorylation | Uniprot | |
S72 | Phosphorylation | Uniprot | |
K76 | Ubiquitination | Uniprot | |
S85 | Phosphorylation | Uniprot | |
K91 | Ubiquitination | Uniprot | |
S95 | Phosphorylation | Uniprot | |
S96 | Phosphorylation | Uniprot | |
Y98 | Phosphorylation | Uniprot | |
K100 | Ubiquitination | Uniprot | |
K105 | Acetylation | Uniprot | |
K108 | Ubiquitination | Uniprot | |
K115 | Ubiquitination | Uniprot | |
K122 | Ubiquitination | Uniprot | |
K127 | Ubiquitination | Uniprot | |
K139 | Ubiquitination | Uniprot | |
Y150 | Phosphorylation | Uniprot | |
S184 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
S200 | Phosphorylation | Uniprot | |
S201 | Phosphorylation | Uniprot | |
S202 | Phosphorylation | Uniprot | |
T203 | Phosphorylation | Uniprot |
Research Backgrounds
Inhibits DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC). It is degraded during the mitotic phase of the cell cycle. Its destruction at the metaphase-anaphase transition permits replication in the succeeding cell cycle.
Inhibits the transcriptional activity of a subset of Hox proteins, enrolling them in cell proliferative control.
Phosphorylated during mitosis. Phosphorylation at Ser-184 by CK2 results in enhanced binding to Hox proteins and more potent inhibitory effect on Hox transcriptional activity.
Cytoplasm. Nucleus.
Note: Mainly cytoplasmic but can be relocalized to the nucleus.
Homotetramer. Interacts with CDT1; this inhibits binding of the MCM complex to origins of replication. The complex with CDT1 exists in two forms, a 'permissive' heterotrimer and an 'inhibitory' heterohexamer. Interacts (via coiled-coil domain) with IDAS (via coiled-coil domain); this targets GMNN to the nucleus. The heterodimer formed by GMNN and MCIDAS has much lower affinity for CDT1 than the GMNN homodimer. Interacts with a subset of Hox proteins, affinity increasing from anterior to posterior types, the strongest interaction being with HOXB1, HOXC9 and HOXD10. Interacts with LRWD1 from G1/S to mitosis.
Belongs to the geminin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.